SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301618228|gb|XP_002938531| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301618228|gb|XP_002938531|
Domain Number 1 Region: 236-341
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 51-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-19
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 888-959
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-18
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 773-839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 948-1016
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 589-658
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.34e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 531-600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 1068-1137
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 829-899
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 648-720
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.23e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 11 Region: 704-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000514
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 342-415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000361
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 13 Region: 405-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 14 Region: 1000-1062
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 15 Region: 477-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 16 Region: 1127-1185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 17 Region: 168-233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000375
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 10-50
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000653
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301618228|gb|XP_002938531|
Sequence length 1451
Comment PREDICTED: CUB and sushi domain-containing protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
milqpspyqyrykclpgftlvgpeiltcrlgnhllfegpppscevhcpdneiltdstgvi
lsqsfpgtyphfqtcswlikvesgynvtlsveyflsekqydefdifdgqpssgkdgpeqt
dpqlglftststkrfalsssnqvllqfhsdaanagifalyfygyrlrkckppitvpngev
lsgseeflmgdivrykclpgftlvgpeiltcrlgnhllfegpppscevhcpdneiltdst
gvilsqsfpgtyphfqtcswlikvesgynvtlsveyflsekqydefdifdgpsgqstlli
slsgnysapltitssgnkvhlrwtsdhaysrkgfkirywalycslprpplhgtvlgpvin
ppggvvrfncdpgfrligmntatclrrpqgyydwnsevplcqamfcgvpaspkngivfgk
eytvgtkamyecdeghhllnpedavseclpsghwsngnnppqcvaitcpdisnlntehgr
wriihkshyhygaelmlicdpgyyyvgpriircqangtwsvgeatptcniiscgelptpa
ngnkigmltqygataifacnsgytlvgsrvrecmsnglwsgqevkclaitcghpgnpgng
itqgsqfnlydvvkfvcnpgyiiegsvqaqcqpngqwshpmptcrilnctdpghveyglr
rvlqkgpdrfsfgtsvtyecshgyylmgthvlscqgdgtwdralprcllvtcgapglppn
aqisgkrftvgsvvqysclgrrilignatrtcqldgrwsgflphcsggsagecgdpgvpf
hglsqgeeftagsvvrfscepgyllrgsaersclingswggfqpecevvscgnpgtpsns
rvvfndglvfsssiiyecregyyssgplsrhctvngtwtgtapdcavincgdpgipangl
rlhhdfqynhtvsfqclpgymmesdkapmllctkdrtwngtkplckaitcpsppvipngk
avgsdflwgssltytcvegyqlslpavltcesnrswvgelpqcfpvfcgdpgipaharrv
drgfsyrssisfscppplvlvgsvrrfcqsdgtwsgtqpscidpshttctdpgipsfgmq
ntsqgfqvgstvlfrcqkgyllqgsttrtclpnltwsgvqpeciphhcrqpetpphanvg
aldlpslgytliyscqagfyltggsehrtcrvdgswtgkppvcladirpsgkpifppkep
pipkisvpadvfaknslwkgsyeyqgrkqpamltvtsfetgsgkvnatmidhsgvelqvs
giykkedfhlllqahqvrgpadifmdkfkidswaldghvssespggtyvyqgfvrgkgfg
qfglqrldlrllgndpdtighfpsnsssvaaailvpfialiiagfvlylykhrrrpkvpf
ngfaghentngratfenpmyernvqpteivaneteftlskvtasvliqnlkcgdddflii
ncpsevkdkvk
Download sequence
Identical sequences gi|301618228|gb|XP_002938531|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]