SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301618415|gb|XP_002938616| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301618415|gb|XP_002938616|
Domain Number 1 Region: 487-719
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-80
Family Eukaryotic proteases 0.000000683
Further Details:      
 
Domain Number 2 Region: 284-371
Classification Level Classification E-value
Superfamily Kringle-like 1.21e-36
Family Kringle modules 0.0000389
Further Details:      
 
Domain Number 3 Region: 11-97
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-35
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 4 Region: 97-181
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-34
Family Kringle modules 0.0000223
Further Details:      
 
Domain Number 5 Region: 187-272
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-34
Family Kringle modules 0.0000401
Further Details:      
 
Domain Number 6 Region: 379-473
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-32
Family Kringle modules 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301618415|gb|XP_002938616|
Sequence length 720
Comment PREDICTED: plasminogen-like [Xenopus (Silurana) tropicalis]
Sequence
mmvmetsqtsriylkecitgkgkdyrgteskthsgktcqnwtgsfphvpnftpekfpnag
legnfcrnpdndlngpwcyttdfsvrfeycnipqceedcmhcsgenyrgrisktasgtec
qnwdsqtphshgyspsnipdknlernycrnpdgeprpwcfttnpnkrwehcniprcttnp
ptsapgvqclsgkgenysgniavtasgktcqewslqvphkhirtpdnypcknleknycrn
pdgesmpwcyttdsetrweycnipscdaptvngkfrnaptnpstilecydgngskyrgta
yitvsgkkcqpwnsqtphkhtkmpdnfpnagleqnycrnpdedkgpwcyttdasvrweyc
slkkcselpsteqrpvqttkittittspdcivskgedyrgiksttlnghicqawssqspq
ehasftpithpqsglesnycrnpdgdingpwcfvttpgtvkweycdiprcattgiecgkp
kkkqrkcfgrivggceaipfswpwqislrtsfnlhfcggtlidrqwvitaahclersnrp
sayrvhfgihkesgneaskqvrqiekffkepsnadiallkltspalisdevlpvclppvn
yvvpdrsecyvtgwgetqgtgkegvlkeagipvienklcnspeylngrvtdrelcagviq
ggvdscqgdsggplscfdgekyvlqgvtswglgcaqpmkpgvyvrvskfipwiqktmnqn
Download sequence
Identical sequences gi|301618415|gb|XP_002938616|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]