SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301619189|gb|XP_002938983| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301619189|gb|XP_002938983|
Domain Number 1 Region: 632-671
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000111
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 766-798
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000291
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Domain Number 3 Region: 723-762
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000025
Family Ovomucoid domain III-like 0.05
Further Details:      
 
Weak hits

Sequence:  gi|301619189|gb|XP_002938983|
Domain Number - Region: 585-628
Classification Level Classification E-value
Superfamily FnI-like domain 0.00209
Family VWC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301619189|gb|XP_002938983|
Sequence length 945
Comment PREDICTED: LOW QUALITY PROTEIN: reversion-inducing cysteine-rich protein with Kazal motifs-like [Xenopus (Silurana) tropicalis]
Sequence
mrrrsgdvmhaakrvmsasasclgllgiwlflivffileaagtrssafssmasvsadasc
cnqakdnlmcrdvceqilssksesrikhlflrapdycptsmidvwtcinsslpgvskksd
gwvglgccelaiavecrrackqasskndiskacrkqyetaliscinrnemgsvccsyagr
htncreycqaifrtdsspgpsqikavenfcasispplvqcvnnytqsypmrnpvdslycc
draedprcqaackrilmskktepeivdslsegctkplpqdplwqcflessravrpgvnia
pppsagldgaelhccskanssncrxaitskvlrtqwgsytnivsyffqynrpvxdlpxcf
lctnrtylrmlsffsrptelfrscniqsdqgamndmklwekgsikmpfmnipvldikkch
pemwkaiacslqikpcnsksrgsiicktdcieiltkcgdhsrfpeshtaesicellspsd
enedcipldsylksspldnaieevthpcnpnpcpanhlcevnrkgclpgepclpyfcsqg
cklgeasdflvrhgvliqmpsgaagcykictcgqsgtlencldtqcvdlqkscivggqrk
nhgesfkvdcnicscvagtlrcsnhqcphseedrrmftglpcncedqfvpvcgqngrtyp
saciarcvglldhqfefglcsskdvcnpnpcsrnercipkrqvcitsyekfgcaqyecip
rqlkcehsrdpvcdtenmehmnlctlyqrgrllsykgscqpfcksaepicghngetypnv
csaysnrvavdyyghcqdvgifsdqglhseclsiqcptipatvckpvtppgaccplcagv
lrilfdkekldtfamatkntpitvmdilqkirqhisvpqcdvfgylsmesdiiilivpvd
sppksiqwldarsvdillggaevkcenlilpnddllgvwdkpdth
Download sequence
Identical sequences gi|301619189|gb|XP_002938983|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]