SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301619198|gb|XP_002938986| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301619198|gb|XP_002938986|
Domain Number 1 Region: 47-318
Classification Level Classification E-value
Superfamily L domain-like 1.79e-59
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 352-445
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-21
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301619198|gb|XP_002938986|
Sequence length 639
Comment PREDICTED: leucine-rich repeat-containing protein 4C [Xenopus (Silurana) tropicalis]
Sequence
MLNKMKLHPPQMMIGPRFNRALFDPLFIVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICTRRNLREVPDGISTNTRQLNLHENQIQIIKVDSFKHLRHLEVLQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
EMKRLSYISEGAFEGLSNLKYLNLGMCNLRDIPNLTPLVKLDELDLSGNHLSVLRPGSFQ
GLTHLQKLWIMHSQIQVIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHNLQRIQLHH
NPWNCNCDILWLSWWLKEIVTTGSTCCARCSTPPSLKGTHIAELDHNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTYVSWITPNGTIMTHGSYKVRISVLNDGTLNFTNVTVRD
TGLYTCIVSNSAGNTTASATLNVTASDTGYTYFSTVTVETMEPSQDEARTTETHVGPTPV
IDWETTNATTSLMPQSTRFTEKTVTVPVTDANNGMPGIDEVMKTTKIIIGCFVAITLMAA
VMLVIFYKMRKQHHRKNHHAPTRTVEIINVDDELTADTPIESHLPMPAIEHEHLNHYNSY
KSPFNHTTTVNTINSIHSSVHEPLLIRANSKDNVQETQI
Download sequence
Identical sequences F6ZMC6
gi|301619198|gb|XP_002938986| ENSXETP00000008353 XP_002938986.1.99540 8364.ENSXETP00000008353 ENSXETP00000008353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]