SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301619292|gb|XP_002939029| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301619292|gb|XP_002939029|
Domain Number 1 Region: 806-921
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 633-752
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 3 Region: 1778-1887
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 4 Region: 163-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-32
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 5 Region: 2116-2235
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 6 Region: 1950-2058
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 7 Region: 466-576
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-29
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 8 Region: 2304-2406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1325-1441
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 10 Region: 980-1100
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-26
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 11 Region: 1152-1272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 12 Region: 1630-1744
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-23
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 13 Region: 3011-3082
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.78e-19
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2713-2781
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.16e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 2656-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-18
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 16 Region: 2952-3022
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2895-2963
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 18 Region: 3071-3140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.13e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2772-2838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.16e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 20 Region: 2827-2888
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000103
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 3130-3186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000139
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 22 Region: 1504-1570
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000102
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 23 Region: 403-474
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 24 Region: 2063-2132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 25 Region: 2408-2481
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 26 Region: 1891-1953
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000243
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 3191-3259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 28 Region: 1575-1639
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 2598-2657
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 30 Region: 2470-2537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 752-818
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 581-640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 1445-1506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 1100-1162
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 35 Region: 1271-1333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 3250-3308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 37 Region: 2542-2601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 927-987
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 39 Region: 2234-2297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000904
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|301619292|gb|XP_002939029|
Domain Number - Region: 128-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0025
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00275
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301619292|gb|XP_002939029|
Sequence length 3546
Comment PREDICTED: CUB and sushi domain-containing protein 3-like, partial [Xenopus (Silurana) tropicalis]
Sequence
ltgfhlpppvtstgsvfslrltsdfavsahgfkifyeggewlmvsiclppggarsmdsiv
siclppggawsigsivsiclppggewsmhhleagfktqnmvsghainihxxxxxxxxxxx
xxxxxxctgyildghpqltciansastatwdcpvpicraedacggtvrgasgiisspnfp
neyhnnadctwtvvtepgdtislvftdfhmeekydyleiegsdppkiglsgmnvpppvis
nknwlrlhfvtdnnhryrgfsaqyqgsslnkttssgeleeqidatpgavtlaitsadvtv
scftdapnkrhceeypvqdvehvlehnvskdlhssppaqtqsirrrprnsgqiertkela
gvthrvkksidfksrgfklfpgkdisskfsilneggikqasnmcpdpgepengkrigsdf
slgatvlfscdedyvlqgeksincqriadvfaawsdhrpvckvktcgsnlqgpsgtftsp
nfpfqydsnaqcvwvitaenpnkviqinfeefdleigydtltigdggevgapktvlqelt
gsfvpdlivsmsnqmwlhlqtdesigsigfkvnykeiekescgdpgtplygiregdgfsn
gdvlrfecqfgfeligqksiackennqwsanipicifpclsnftapmgtvlspdypdgyg
nnlnciwtiisdpgsrihlsfndfdlemqfdflaikdgdsldspilgtftgaevpshlts
nshilrlefqadhsmsgrgfnitystfghnecpdpgvpinarrfgdnfqlgssvsvvced
gfiktqgtetitcilkdgkvmwsgpiprceapcgghfsspsgvilspgwpgyykdslnce
wvieaepgrsikisferfqtelnydvlevhdgpnllspllgsyngtqvpqflfssvnyiy
llfttdnsrsnngfkihyesvtvdthscldpgipvhghrygydfsigstvsfgcqpgytl
sheepllcekshwwshplpncdalcggdvrgpsgtilspgypeiypnslnctwtievthg
kgvqftfhtfhledlhdyllitengsftqplarltgselptainaglygnfraqlrfisd
fsisydgfnitfseynlepcedpgvpqygkrfghsfgvgdtimftcsagyrlegiseiic
lgggrrvwsaplprcvaecgasatsnegillspnyplnyennheciysiqvqagkginis
artfhlaqgdvlkiydgrdntahllgaytasslrgltlsstsnhlwlefnsdfevtdegf
qlvytsfelshcedpgvpqfgykisdqghfagstiiygcnpgytlhgssllkcmtgerra
wdyplpsciaecggrfkgessgrilspgypfpydnnlrctwiievdlgnivslqflafdt
eashdilrvwdgplenemllkeisgslipegihstlnivtiqfdtdfyisksgfaiqfss
svatacrdpgvpmngtrngdgrepgdtvifqcdtgyelqgeeritciqvenrffwqpspp
sciavysfsiepnydflyiydgpdsnsaligsfqdsklperiesssnnmhlafrsdgsvs
ftgfhleykaklrescfdpgnimngtrlgmdyklgstvtyycdagyvlqgystltcimgd
dgrpgwnrvlpschapcggrstgpegtvlspnypknysighncvysvavpkefvvfgqfv
ffqttlhdvvevydgstqqssllsslsgshsgeslplssgnqiiikftsigpmtskgfhf
vyqaqrktenftkyadtleiefnnmvkyntdssvvlvpcggiltkrkgtilspgypepyd
nnlnciwkitvpegagiqvqvvsfatehnwdsldfydgsdnnaprlgsysgttippllns
tsnnlylnfqsdisvsaagfhleytaigldscpepqmpssgikvgdrymvgdvvsfhcdq
gyslqghshitcmpgpvrrwnypipiciaqcggamadfsgvilspgfpgnypssldctwt
vklpigfgvhlqfanfstetihdylevrsgsadagsvigrlsgpqlpaslfstthettly
fhsdysqnkqgfhilyqayqlqscpdprpfrngfvigsdftvghtisfecypgysliges
altclhgvsrnwnhplprcdalcggnitamngtiyspgypdeypnfqdclwlvkvppgng
iyinftvlqtepiydfitvwdgpdqnspqigqfsgntalesvystsnqvlikfhsdftts
gffvlsyhayqlricqppslvsnaeilaeddeyeigdiiryqclpgftlvgnevltcrlg
erlqmdglppscqvlcpaneirldstgvilspgypdsypnlqmcawtisvekgynitlyf
effqtekefdvleafdgpnshhpllislsgdysstfnitssghevfvrwsadhgtnkkgf
riryianycstpespphgfiisqtggqlnslvrwacdrgyrligkntaicrkapygyytw
dapvpacqaiscgvpkaplnggilatdylvgtgityfcsdgyrlsskeltaavcqpdgtw
snhnktprcvvvtcpsinsftlehgrwrivngshyeyktkvvfscdpgyfrlgpasiqcl
angtwswrnerphcqitscgelsippngkkigtqttfgstaifacdtgymlvgsavrecl
ssglwsgtetrcfaghcgtpelivngqvigdnygyrdtvvyqcisgfrligssvricqqd
hnwsgqlpscvpvscghpgspiygrtsgngfnyndvvtfscntgyimqgptraqcqanrq
wshpppickvvnctdpglpensireskiehgnftygtvvfydcspgyflfgspvlvcqpn
gywdkslpecimidcghpgvppnaiisgekftfgstvhysctgrrtlighstrtcqlngh
wsgslphcsgdtagscgepgipthgsregtefrtrsklrfsceigyilrgseertclsng
twngkqpeckavqcgnpgttangrvfriddttfsstviyscldgyilsgtnirqctangt
wsgalpnctiiscgdpgvpanglrygedyivgqnvtyvcqpgytmdpkisatrmctsngt
wsgiipvckavtcpsppqvsngkiegtnfdwgfsisyvcspgyelsfpavltcvgngtws
gevpqclpkfcgdpgipangkregksfifqsevsfmcslpyilvgsntricqadgtwsgs
pprcieptwtscenpgtprhgfqnntygyqmgktvqfsckkgyllhgstsrtclpdltws
gipteciphsckqpesplhsnvvgmdlpslgytliyscqpgymlsggtehricqpdntws
gkvpvcragskplenknkpvpgtpspklnvpddvfarnyiwkgfcifkgknqpmnftvnr
fntstgkvnatliisnaefllsgiyksqearlilhiysvkssaqtsvakmkdekwamdgf
vsaesdgatyvfqgsihgkdygnfglrsiginmteenpanhsfgtnsssvaiailvpffa
lifagfgfylykqrtapktqytgcsvhennngqaafenpmydtnaksvegkavrfdpnln
tvctmv
Download sequence
Identical sequences gi|301619292|gb|XP_002939029|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]