SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301620122|gb|XP_002939430| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301620122|gb|XP_002939430|
Domain Number 1 Region: 505-802
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-75
Family Protein kinases, catalytic subunit 0.000000762
Further Details:      
 
Domain Number 2 Region: 213-404
Classification Level Classification E-value
Superfamily Fibronectin type III 1.49e-26
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 25-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000324
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 
Domain Number 4 Region: 125-212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000254
Family I set domains 0.0009
Further Details:      
 
Weak hits

Sequence:  gi|301620122|gb|XP_002939430|
Domain Number - Region: 411-467
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0235
Family ABC transporter transmembrane region 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301620122|gb|XP_002939430|
Sequence length 894
Comment PREDICTED: tyrosine-protein kinase receptor UFO-like [Xenopus (Silurana) tropicalis]
Sequence
MECMPAVLMLMAILTAAFGENDYYFMENPSNITSSLGKDIVLRCSVKVKETFPDVEWLHN
GVPLEFADSNQIQMPLDEDEQWLVISELSIPSLQLSDSGQYSCAVTIEGEEILSDEAYLE
LEGLPVFIEEPQDLDTYPNQSFNLSCYAQGPPDPVYVIWLQNGAPLNSLKDALALPPSFL
EVKGLNKSSLFSCEAHNAKGVTTSRTATIKVLPEKPRDLQLLSQSSTELEISWQPGRSGV
HPQHICTVQASLPHSGFSTHPHHKIYNQNLNVPPYSHVIGSLTPYTTYNVRVACLSSEGV
SHWTDWVAMKTTEGVPAGPPENVTLTTNGTVTIVMWTEPQPPINGILLGYKLAYRIKEME
EVVVDAGLTNKEILETANPEDLTVRVASYTNAGDGPWSDPVTFSSIMDTSTPFTSAVVNP
APLFSWHWWYVFLAVAVAFFCAICIAIFLARIRKKETRYGEAFEPTVEQGELVVHYRVKK
SYSRRTTEATLNRLGISNDLKEKLRDVMVDRHKLALGKTLGEGEFGSVMEGQLNQDDYIL
KVAVKTMKIAICTRTEMEDFLSEAVCMKEFDHPNVMRLIGVCLQNTENEGYPSPVVILPF
MKHGDLHSFLLYSRLGDTPLFLPTQTLVKFMTDIASGMAYLSSKNFIHRDLAARNCMLNE
NMNVSVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTTKSDVWSFGVTMWEI
ATRGQTPYPGVENSEIYDYLQQGNRLKQPPDCLDGLYELMSSCWQLNAKDRPCFDTLYRE
LEKISKNLPPIKDPEEILYVNMEDASSPLSEDFGELGAVGGQDAKDLGDDIFFKAGPVTA
EVHHSENSNRYVMCPAHETTRLLGTTTSTDHPSYSSALDEGTIEEVITSTGFRQ
Download sequence
Identical sequences A0JP83
gi|117558067|gb|AAI27292| gi|147904872|ref|NP_001090657| gi|301620122|gb|XP_002939430| NP_001090657.1.99540 ENSXETP00000030202 ENSXETP00000030202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]