SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301620455|gb|XP_002939591| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301620455|gb|XP_002939591|
Domain Number 1 Region: 231-292
Classification Level Classification E-value
Superfamily BPTI-like 5.39e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 2 Region: 366-427
Classification Level Classification E-value
Superfamily BPTI-like 1.15e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 3 Region: 137-232
Classification Level Classification E-value
Superfamily PKD domain 0.00000000922
Family PKD domain 0.014
Further Details:      
 
Domain Number 4 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301620455|gb|XP_002939591|
Sequence length 511
Comment PREDICTED: kunitz-type protease inhibitor 1-like [Xenopus (Silurana) tropicalis]
Sequence
mgylqsllvllfvaagsvwsdsdgetcldkftkgfhdfvldldysvksgatflsspplhs
grdcmtaccrtlgcnlalaqetdngedvinscflincvyeqefvckfirkpgfvnfitmd
vynkyqammeqegdedhppiaragpdvrtqplqtviltgiesldregivsyewsllhgdp
svvyevipatesdvphsievtnlhagqyifqlvvtdtaeqqnsatvtitvlstaeteehc
faphkvgrcrgsftrwyfnpetndcleftyggckpnknnylriedcrqtcrnnsaehtat
gdhsgkssrrlhpvcdghcspnqfqcaqgccidvglecdehqdcpdnsdelfcenydkgf
kklqtfeipnskarcvdlpdtgpcrasfsrfyydpnirkclrftyggcagndnnfhresd
cmrycegvserdiigrrlgdteaqkegsgsaevaaavflgicilvvlavigycvikrrks
srrrqpvantntlattedtehlvynrttkpv
Download sequence
Identical sequences gi|301620455|gb|XP_002939591| XP_002939591.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]