SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301620989|gb|XP_002939857| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301620989|gb|XP_002939857|
Domain Number 1 Region: 40-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000097
Family Ovomucoid domain III-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301620989|gb|XP_002939857|
Sequence length 83
Comment PREDICTED: pancreatic secretory trypsin inhibitor-like [Xenopus (Silurana) tropicalis]
Sequence
mkllinllllafllcsfagyikavpestngrepkcesymvngcprirspvcgsdnnsyen
ecllcsenlkrnihlrvirdgsc
Download sequence
Identical sequences gi|301620989|gb|XP_002939857| XP_002939857.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]