SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621014|gb|XP_002939855| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621014|gb|XP_002939855|
Domain Number 1 Region: 96-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000998
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 27-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000222
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 3 Region: 153-193
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000222
Family Ovomucoid domain III-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301621014|gb|XP_002939855|
Sequence length 194
Comment PREDICTED: ovomucoid-like [Xenopus (Silurana) tropicalis]
Sequence
mkaaavfvliaavlgsfpgirsdqintkidcsiyqkldddgglactkeinplcgtdgvsy
dnpcmlcaanlkqmsiigvkskgycripkkqlncdiykimpddytmcgndykpvcgtdge
sydnecwlcavrlqqntsidikyggpcdipgykvdcsmfkpddvkkpctedfnqlcgidg
vtysnkcelchaal
Download sequence
Identical sequences gi|301621014|gb|XP_002939855|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]