SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621421|gb|XP_002940052| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621421|gb|XP_002940052|
Domain Number 1 Region: 350-540
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 3.92e-78
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000147
Further Details:      
 
Domain Number 2 Region: 25-119
Classification Level Classification E-value
Superfamily A heparin-binding domain 2.35e-44
Family A heparin-binding domain 0.0000041
Further Details:      
 
Domain Number 3 Region: 120-185
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 5.23e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000516
Further Details:      
 
Domain Number 4 Region: 280-338
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301621421|gb|XP_002940052|
Sequence length 745
Comment PREDICTED: amyloid-like protein 2 [Xenopus (Silurana) tropicalis]
Sequence
mylnpatgkeqgkalaanagagfavaepqvamfcgklnmhvniqtgkwepdpsgtkscig
tkeevlqycqevfpdlqitnvveanqpvsidnwckkgkkqckghshivvpfkclvgefvs
dvllvpekckffhkermdvceghqhwhnvakeacmtevmvlhsygmllpcavdqfrgaey
vccpqtkildealskeeeeeddeeededdydlyksefpteadvedftaaaeeeeeeeeve
devvedrdyyydnykdedynnenpteppnerqpsgkdiitdvksvcsqeamtgpcrammp
rwyfdlgqkkcvrfiyggcggnrnnfesedycmavckvmmaqtpapaddvdvyfetladd
neharfqkakeqlevrhhnrmervkkeweeaesqaqslpkaerqtliqhfqatvkaleke
aasekqqlvethlarveamlndkrrnalenylsalqadsprphrilqalkryvraenkdr
lhtirhyhhvlavdpekaaqmksqvmthlhvieermnqslsllykvpyvadeiqdeidel
fqeqrtdmdqftssfsesqgdvrvsseeseeilpkdgkpfrpfqvktfpsiteseetqrd
sylpvrkgsgmadlntligaeekiinskskadqkvvidetldvkemifnaervsglvdep
dtdgplrnefsfssgaligllviavaiatiivislvllrkrqygtishgivevdpmltpe
erhlnkmqnhgyenptykyleqmqi
Download sequence
Identical sequences gi|301621421|gb|XP_002940052|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]