SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621429|gb|XP_002940051| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621429|gb|XP_002940051|
Domain Number 1 Region: 720-923
Classification Level Classification E-value
Superfamily Fibronectin type III 1.76e-34
Family Fibronectin type III 0.0000152
Further Details:      
 
Domain Number 2 Region: 307-400
Classification Level Classification E-value
Superfamily Immunoglobulin 7.9e-24
Family I set domains 0.0033
Further Details:      
 
Domain Number 3 Region: 406-523
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 229-317
Classification Level Classification E-value
Superfamily Immunoglobulin 5.63e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 28-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000544
Family I set domains 0.027
Further Details:      
 
Domain Number 6 Region: 123-200
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000441
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 575-674
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000301
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301621429|gb|XP_002940051|
Sequence length 1252
Comment PREDICTED: cell adhesion molecule-related/down-regulated by oncogenes-like [Xenopus (Silurana) tropicalis]
Sequence
MHPDPRPWHPLLCFLVLVVSTSANSDVTPHFTSEPLSTVQKLGGPVTLLCTAEPPWAHIS
WLFNGELLERISSQGVDIQSGHLTIPSLGTAHIGQYQCIASTSVGAILSRPATVSVAYLN
DFETTIGHSVTAEEGSSEFIGCKIPESNPKAHVRYKVRGKWLKESSDKYLILPSGNLHIL
NVSLEDRGTYRCAAYNPVTHELKPNPSTVKLSVNRSPQVDSHILHPVIAQTVLVQIHDPL
TLECVVGGVPNHSQVYWYKGGKEAEAYGRRKLLHTHLVIEQVQRSDAGNYSCVFDNGSGV
FQRVNYTLTVLEPPSISQKNEDQSLIMGSNVRFSCESRGNPSPNITWFHNAVQIHPSAHH
QISGNKLRITNLIAEDSGIYQCFANNGVGSAQVSQRLTVKSETWSKPVIVSPPTSIRVAN
GDLVTLTCNATGIPTPTIRWYDSHGPISSHPSQVLRSKPRKALMSKIGNLGLHQDPVHLI
MSQAGSSSLYIRAITVQHSGKYTCEATNEFGSAHADAFLTVVPYEMSTKPEDITPLDLTQ
SDEGDYDSETRAPSHSQLNEHEPESRVTEKPYSGASLPEAPIILSPPQTTKPDMYNLMWR
SGKDGGLPINAYFVRYRKLDDDGNMVGNWNSIRVPASENEFPLTELESSSLYEVLMVARN
AAGEGQPAMLTFRTSKERSSSSKNTQAPFPPIGDNKQTVIHGVSNSNFGLVPMDPSRHSG
VPEAPDRPTISTASETSVYVTWIPRANGGSPITSFKVEYKRTGGHWNTASENIPPSKLSV
EVSNLEPGGLYKFRVIAINNYGESRRSTVSRPYQVAGYSSRLPNPLIVGPRIDQTEAVTD
TQILLKWTYIPENNNNTPIQGFYIYYRPTDSDNDSDYKRDMVEGTKQRHLISHLQPETSY
DIKMQCFNERGASDYSNVMMCETKARRGPGASEYPVLDLSTPSVPDRSSSPSHSPARSGD
FLYVIVGCVLGGMVLILMAFIAMCLLKNRQQTLMQKFEPPGYLYQGADLNGQIIEYTTLP
GTSRINGSVHTGFMGNGNLNNGCPHIHHKVHNRASGVGNGEMYPGCNSSLKETYVDYERL
PHHLSNGRVMYTALPQTDPTECINCRNCCNNNRCFTKPNGSYCGNGVAVMPVGMAPQQDE
GETNPLNHVMVPMCLTSPDQRFSEEIEEDHNEKETQLSTNSICVEEATQTETEQQEGEDC
NKTEGDSSILTWAPLILPAISKDCNEKHSWTSTDNTLDKSNADQPQLQTQEA
Download sequence
Identical sequences gi|301621429|gb|XP_002940051| 8364.ENSXETP00000000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]