SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621811|gb|XP_002940234| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621811|gb|XP_002940234|
Domain Number 1 Region: 29-134
Classification Level Classification E-value
Superfamily Immunoglobulin 5.26e-19
Family V set domains (antibody variable domain-like) 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|301621811|gb|XP_002940234|
Domain Number - Region: 207-258
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0158
Family Complement control module/SCR domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301621811|gb|XP_002940234|
Sequence length 293
Comment PREDICTED: CMRF35-like molecule 5-like [Xenopus (Silurana) tropicalis]
Sequence
mkvpaiytaqwalvtvlstlrgircltgpaspvpvhsresltvrcsyqtgfethkkywck
ggfwkncdiviktsgtegettsgrfsirdeqtqqtfsvtmtgvtqededtyfcgverfwt
addmyeikvtvlpgvcrreapwtdvldfpetfqelsvgesigvscreqyekktlvlqcke
eagnvhfsprdlltsckekcrrvgilspnitlfpdqeyygpgeevtvrcpegsepnvrvl
qcvpeatgnrwnttrvfcsqtttdpagpnlgnlfisedrsesdaaesvndtin
Download sequence
Identical sequences gi|301621811|gb|XP_002940234|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]