SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301622667|gb|XP_002940650| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301622667|gb|XP_002940650|
Domain Number 1 Region: 124-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family Cripto EGF-like domain-like 0.0086
Further Details:      
 
Domain Number 2 Region: 85-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301622667|gb|XP_002940650|
Sequence length 191
Comment PREDICTED: cryptic protein-like [Xenopus (Silurana) tropicalis]
Sequence
mlyrdhgrfiiitlalltfycckgliieaveysnkgrsnttkedllinhsrtidtfynln
kdnekrnhhkteplvpfvgltdssklskqccnnggtcvlgsfcvcpryftgrycefdera
khcaakiqhgewmrkgcrlcrctygvlhcfvetqtdcdeveeeempssvpmeqssiylil
sgivfsiytli
Download sequence
Identical sequences gi|301622667|gb|XP_002940650| NP_001272393.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]