SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623007|gb|XP_002940814| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623007|gb|XP_002940814|
Domain Number 1 Region: 1053-1304
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.33e-83
Family Eukaryotic proteases 0.0000772
Further Details:      
 
Domain Number 2 Region: 523-673
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 4.84e-26
Family Cu,Zn superoxide dismutase-like 0.00088
Further Details:      
 
Domain Number 3 Region: 685-822
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 2.23e-21
Family Cu,Zn superoxide dismutase-like 0.001
Further Details:      
 
Domain Number 4 Region: 371-516
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 3.27e-18
Family Cu,Zn superoxide dismutase-like 0.0043
Further Details:      
 
Domain Number 5 Region: 835-960
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 0.0000034
Family Cu,Zn superoxide dismutase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301623007|gb|XP_002940814|
Sequence length 1321
Comment PREDICTED: hypothetical protein LOC100495179 [Xenopus (Silurana) tropicalis]
Sequence
mlamtltascmavshirqqgsnlsgaslefiidndddkgdraitmepstsnsaatsdeqi
nmdtddaiknskteqgsrglsdekesiaapavlgskqelilemhkdllesnrlylimvcs
vigigcvllslaiiflarkiaklssekpdivaaeegslcqgefsaqidmegvrgyisfni
ssqtitanlsgtckninisvhefpvfygasqdpchtrnvgpshyqlglsnssqeslkwpl
gqsvvveacghrscrnlhdtrgplqiwhatfhslvvghiyflkvmdedpivvltelalpq
gipespaslffansceaqvnqslgnftvgnrtealksrkelppttimpfaslefqgkiic
aklkalrsktasahvsmngvsghfnfrqnsplhpteidlnlrnlkgqfgeysihslpvla
rrdpgenlcnknstgdiwnplgvnrsassyptqpgsahhlwemgdlsgchgslqgyeemr
tklidwnlplygnnsvvgrsvvlskangtewvcstirqegdmvvatasfhkgvvgrvmfr
qsledvdndlsilvelsslsgqtsnghnwhvhefplqmesdscasagghfnpynvstggn
ykyeckylnpllcelgdyagrhtpitlagphptrylftdsyssltgpnsilgkalvihgp
dgaaprlacaniipqhpvegktgpwfgsgdaqgmltasqisdldptainisfyelrnrsg
gfhihvlpvisgsvapcsdslikghfnpfgvnvstsppagngtddeyevgdisgrrgllv
gkdslvkqfidmnfplsgthsilgrslvihytngsrmqcanvlpelkfggdyiraqakfn
gsisgsismtqviypdggfsdtiilvdflstpgndnkstnlqwfipnepngtefynpyei
paegenmcrsqsplhckvgdltskhgvvsaqkrnlltdinlplaseftvigrflmvkkdt
lepisaqilpdvpvftvklpavtpfnrtafrkavsvalkvpswkvilisgghgrnetcyp
vtffiigfndtaalasletpgslgpfstssscksgcgrptttrivggqdtmpgeipwqls
lrklglhicggslinnqwaisaahcfagpirvsdykvnlgayqlsvpsgifvdvaavyvh
ptfkgagsigdialiklanpvqftdyiipvciptqnvvfpdgmncivsgwgtinqqvslp
ypktlqkvrvpiigrascdqmyhinnptlppyqsiimwdmicagykagrrgscqgdsggp
lvcpwngswllagivswgfgcaqpnkpgvytsvpaysawiqeyvpslqltqpqisalnnt
g
Download sequence
Identical sequences gi|301623007|gb|XP_002940814|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]