SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623207|gb|XP_002940911| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623207|gb|XP_002940911|
Domain Number 1 Region: 3813-4012
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-38
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 3224-3328
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-31
Family Cadherin 0.00062
Further Details:      
 
Domain Number 3 Region: 1551-1674
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-30
Family Cadherin 0.00061
Further Details:      
 
Domain Number 4 Region: 3330-3441
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-30
Family Cadherin 0.0007
Further Details:      
 
Domain Number 5 Region: 3120-3223
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-30
Family Cadherin 0.00048
Further Details:      
 
Domain Number 6 Region: 2803-2911
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-29
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 1128-1257
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 1021-1139
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.00042
Further Details:      
 
Domain Number 9 Region: 2277-2383
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-26
Family Cadherin 0.00098
Further Details:      
 
Domain Number 10 Region: 817-928
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-26
Family Cadherin 0.00053
Further Details:      
 
Domain Number 11 Region: 916-1030
Classification Level Classification E-value
Superfamily Cadherin-like 5e-26
Family Cadherin 0.0021
Further Details:      
 
Domain Number 12 Region: 138-265
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-25
Family Cadherin 0.0024
Further Details:      
 
Domain Number 13 Region: 1760-1880
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-24
Family Cadherin 0.002
Further Details:      
 
Domain Number 14 Region: 2070-2177
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-24
Family Cadherin 0.0025
Further Details:      
 
Domain Number 15 Region: 3018-3126
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 16 Region: 1445-1555
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-24
Family Cadherin 0.00086
Further Details:      
 
Domain Number 17 Region: 460-559
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 3429-3548
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 19 Region: 1662-1766
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 20 Region: 2913-3024
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 21 Region: 711-823
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 22 Region: 2177-2284
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 23 Region: 1868-1994
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-21
Family Cadherin 0.0031
Further Details:      
 
Domain Number 24 Region: 2585-2695
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 25 Region: 2481-2598
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-20
Family Cadherin 0.0032
Further Details:      
 
Domain Number 26 Region: 2385-2493
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 27 Region: 1358-1457
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-18
Family Cadherin 0.0066
Further Details:      
 
Domain Number 28 Region: 563-665
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 29 Region: 1979-2082
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-17
Family Cadherin 0.0035
Further Details:      
 
Domain Number 30 Region: 1234-1347
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-17
Family Cadherin 0.0036
Further Details:      
 
Domain Number 31 Region: 2702-2810
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000571
Family Cadherin 0.0038
Further Details:      
 
Domain Number 32 Region: 368-454
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000004
Family Cadherin 0.0035
Further Details:      
 
Domain Number 33 Region: 34-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000443
Family Cadherin 0.0058
Further Details:      
 
Domain Number 34 Region: 3542-3632
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000011
Family Cadherin 0.0099
Further Details:      
 
Domain Number 35 Region: 4041-4168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000013
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 36 Region: 4016-4053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000754
Family EGF-type module 0.01
Further Details:      
 
Domain Number 37 Region: 274-356
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000757
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301623207|gb|XP_002940911|
Sequence length 4590
Comment PREDICTED: protocadherin Fat 1-like isoform 1 [Xenopus (Silurana) tropicalis]
Sequence
MGRYLIMLLLLLILQHLGNCEGSHGLHTSSSSMQFTQYSYNATVYENSAAKTYVGHPTKM
GIYLKDPSWDIKYKIISGDNENIFKAEEHNLGDFCFLRIRTKGGNTAILNREVKDNYLLT
VKAVEKNSNAEARTRIRVQVLDTNDLRPLFSPTSYSVSLPENTAIRSSIAKVTATDADIG
TNGEFYYSFKERTDMFAIHPTSGTIVLTGRLDYTETKHYEMEILAVDRGLKLYGSSGISS
MARLNIYVEQANEHAPVISAVRLTHPELDKDLTYAIVTVDDNDQGPNGEIASLSIIAGDP
LQLFKTTRTSPGSKEYKIVAVKETEWEMQPFGYNLTLQAKDKGSPPQFSATKVIHLTSSR
FKYGAVKFEKDIYRTEISEFAPPNTPVVLVKAVPSNSHIKYAFRNSADKNRFSINPNTGL
ISTLSPVKAKILSHIELDIITSDKKAFTKVLIKVLGTNINTPEFTQTSYKAVVDENSPIG
SSVFSVHAVDHDEGENGFITYSIANINPQPFAIDAFSGVITTLEDLDYELMPRIYTLKIR
ASDWGLPYRRETEIPVTITLNNLNDNIPLFEKVNCEGTVPKDLGVGEQITTVSAIDADEL
QLVKYRIESGDELDLFTLNPNSGVLSLKQPLSEGPANKVSFYSLRITATDGENLAQPIYI
NITVTSSRKGVHLNCEETGVAKMLAERLLQANKLFNRGTQEEVYFDSHMTNTHAPHFKSI
LPSIIAIKENVPVGANIIHMEANDLDAGFSGKLLYAISGGNDDSCFAVDMETGWLKILSP
LDRELKDQYNLNITVYDLGIPQKSSWRLLDVNVLDVNDNPPEFLQESYSVHLKENEEGHN
AIIQVQAVDKDLGVNGEVKYSILTDTDIFTINSETGVIKAVAPLDREKQHTHLLKIEARD
QAENEPQLFSHVLLKVTVEDVNDNPPVFIPSNYHVKVREDLPVGTVITWLDAYDPDVGLS
GQVRFSLLENGDGKFEVDKVSGAVRIIQELDFEEKQVYNLTARAKDRGKPVSLSSACYIN
VELIDVNENLHTPLFSEFVSKGSIREDVPIGTPVMTVSAHDEDTGRDGEIRYSIRDGSGV
GVFTIHEEKGTIRTADNLDRETTSHYWLTVYATDRGVVPLSSFIQIYIEIEDVNDNAPQT
VEPVYYPEVMENSAKDVSVVQINAFDPDSISSDKLTYKISTGNPQGFFAINPKTGLITTT
SRKLDREQQSEHILEVTITDNGHPAKSAVTRVIVKVLDENDNKPQFLQKFYKIRLPEREK
PERERNAKRDPIYRVVAVDKDDGANAEISYSIEEGDEHGKFFIEPKTGVVSSKKSSAAGE
YDILSIKAVDNGRPQKSSTTRLHIEWIAKPAPSAEPITFEEPSFSFSVMESDPVAHMIGV
ITTEPLGSPLWFDITGGNYDSRFDVDKGTGTIIVARPLDAEQKSNYNLTVEATDGTRSVS
TQVSIKVIDTNDHRPEFSTSKYEVLIPEDVQPDTEILQVIAIDRDEKNKLIYTLQSSTDP
VSLKKFRMDPATGSLYTTEKLDHETMQQHILTVMVRDQDVPVLRNFARIVINVTDTNDHA
PWFTSSFYEGRVYESAAVGSAVLQVSALDKDKGKNAEVGYSIESGNTANAFTIDPVLGII
KTAKELDRNNHGRYELVVKATDHGIPPLSQITSIHIFVTISNNAAPKFTKKEYSSEISET
AHVGSFVAMLSAYSQSSVVYEIRDGNTLNSFDINPNSGVVTTQKQLDFETLPSFTLTVQA
TNMAGLSTNSTLTVHVRDENDNFPVFAQTNYRGLISESAPPNSVVLTDDNIPLVIRATDS
DQESNALLVYQIVEPSVHKYFAIDSSTGALRTLLSLDYEQTNIFHFTVQVHDMGYPRLFA
ENAANVTIYVVDINDCAPVFSKDVYETSLLLPTYKGVRVITVNATDDDSGAYSQLIYSII
EGNIGDKFLIDPLKGTITVQNTTNLRSRYELTIRASDGRFSSLTSVKINVKESKESSLKF
TQRSYSATVLENATKVKTLTIISPLGSRINEPLFFHILNPDPRFKISPTSGVLSTTGIPF
DREEEDLFELVVEVSDEQKPPTVAHVLVQVTVEDVNDNNPVFVNLPYYAMVQIDAPEGHL
IRHVTAVDRDIGKNGEITYYLKEHSQQFQIGPSGEIKLKKQFDPDSSNKEYFITVVAKDS
GNPSYSSEVVVPITVMNKAMPVFENPFYSAEIAENANLHSPVVHVQANSPEGYRIIYSIT
DGDPFNQFNINFNTGVINVFAPLDFESHPAYKLRVRATDSLTGAHAEVFVDIILEDVNDN
PPVFREKTYAATLSEASVIGTSVVQINAKDPDSGQNNAISFHLVETSGNISQYFHIDASS
GLIETAKPLDYEYFQECTLVVRATDNGIPPLSNDISVHIGLTDLNDNPPAFIQQVYEVKI
SELSKPGHFVTCVKATDADSSDTEKLEYSILSGNDDMNFIINSKTGVITVSYLRKMILNP
FYSINVSVSDGVFRSSAQVHVTVKSANLHSPKFGQNEYEVELSENSPVQTLVTELKAVDE
DKGLYGQLTYHIINDFAKDNFNINERGQLFTAERFDREIPTNKVIPVSVMAKDTGGKVGF
CIVNVILTDSNDNVPQFRATEYKVSIASDVPRGTPIVKVIASDSDEGANADIFYSIEAQS
ASVEENFGISQSSGTIITKESLIGLEDEVYSFFVKATDGGTPQKESLVPVFIRILPPEVV
LPKFSEPFYTLSISEDTAVGTELDVVKAESNEPIIYSLMKGNTLESNLDDVFVIDKQNGR
LKLEKQLDHESTKWYQFYVLAHNLHGEHEIISSVDVSILVKDVNDNAPVFDSNPYKAFIV
ENLPEGTKVVQVRAFDLDVGSNGQVSYMLGHSQDLEEIKELFSVDRETGWVTTLGELDHE
KTNKYHIVVVAYDHGDKVLSSSSTIEVTVMDVNDNPPRFTAEIYKGTVSEDDPPDGVIAI
LSTTDNDTEEINKEVTFHITGGDPLGQFAIENMQHEWKVYVRKPLDREVKDNYLLNITAT
DGTFATKAVVEVKVLDANDNTPVCEKTSYAETISEDALAGRVILQVAASDADIRSNAEII
YTLHGVGAEKFHLNPFTGELKTSLPLDREILEVYHLMVKATDGGGRFCQAAVELTLEDVN
DNAPEFSADPYTVTVYENTEPQTPLLRVQAIDADLGLNHKVQYSLVSSAEGQFSIDELSG
IISLEKPLDRELQAVYTLTVKATDQGLPRKLSSVASVVVSVLDINDNPPVFEHREYGSSL
TEDAPVGTEVLQVYATSRDIEVNAEITYKIISGNEHGKFTINPVTGMIFIIASLDYETSP
EYYLTVEATDGGTPPLSDVASVNINVTDVNDNSPVFSQNTYTTVVGEDSVSGQSVLMVVA
DDADGPLNNHIRYSITEGNPGNTFIIDPVRGEVKVNKLLDRELISGYTLTIQAEDNGQPP
RRNTTTVNIDVSDVNDNPPMFSKGNYSIVIQENKPVGFSILHLAVTDKDSSHNGPPFTFV
FLSGNEDNTFQMDEQGLITTAGTLSRKIKDLFVLHIQVSDNGKPQLSSFTNIEVRVIEES
IHPPAILPLEIYITTFGEEYSGGVIGKVHATDQDVYDTLTYSLDPKMENLFSVSKTGGKL
IARKQLDVGQYLLNVSVSDGKFTTAADITVHIRQITQELLNHSITFRFANLSPEEFIGDY
WRNFQRSLRNHLGGRKIDIQIISLQPSEPPRNLDVLLAAEKVGNTYFAPKVLIQKINASI
AEIEDISGVKILDVFHKLCLDVECPLRFCDEKISVDESVMSTHSTARLSFVTPRHHRRAI
CLCKGGKCPTLDSLCDGNTCPEGTECVVDVKEGKFNCVCPSDRPGQCNVGSSVTFTGNSY
IKYRLMENENKEEMKLSLKLRTYSAHAVVMYARGTDYSILEIQGGKLQYKFDCGSGPGIV
SVQSIHVNDGQWHTVSLEVDGNYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHMRQQ
GSKHGRNLQVTNGFRGCMDAVLLNGQELPLNSKSKNNVHIEESVDISSGCSLSAADVCSG
SPCQNGGTCSPLSNGGYYCKCSSLFMGTHCDISINPCASNPCLYGGTCIVVKEDFMCHCR
GDYTGPRCQFGPYCKDNPCKNSGKCIDSLDGPVCECESGFHGDKCLNDIDECLENPCPTG
AMCENTYGSYSCNCSNGYGGKLCTDVLPNKYVSTSWNIGLAEVIGIIVFIAGTFSIVVIF
VVCRTVANKKKKKRQSEPEDKHSGATSAFLPRQFLDPKVNKNIYSDIPPQVPVRPISYTP
SIPSDSRNNLDRNSFEGSTIPEHPEFSTFNPDSVHGHRKAVAVCSVAPNLPPPPPSNSPS
DSDSIQKPSWDYDYDAKVDLDPCLSKKSLDEKACHLYNPRESMSEIQSLSSFQSESCDDN
GYHWDTSDWMPSVQLPDIQEYPHYEVVEEPAPHYTDPNVIDTDYYPGGYDIENDFPPPPD
DFPLPDELPPLPPEYTEQYDSMQPSREMPVVGSLGSSTKSSPRYNLNKYLPRHQYPTSMS
EPQSTTSGDGNSYREPYAASYMLGFNRDFEVPIVDNMSMSGYTSAASCTDVSAGCEMESE
VMMSDYESGDDGHFEDVTIPPLDSQHHTEV
Download sequence
Identical sequences F7DJ38
ENSXETP00000037350 gi|301623207|gb|XP_002940911| 8364.ENSXETP00000037350 ENSXETP00000037350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]