SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623209|gb|XP_002940912| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623209|gb|XP_002940912|
Domain Number 1 Region: 3781-3980
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-38
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 3192-3296
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-31
Family Cadherin 0.00062
Further Details:      
 
Domain Number 3 Region: 1519-1642
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-30
Family Cadherin 0.00061
Further Details:      
 
Domain Number 4 Region: 3298-3409
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-30
Family Cadherin 0.0007
Further Details:      
 
Domain Number 5 Region: 3088-3191
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-30
Family Cadherin 0.00048
Further Details:      
 
Domain Number 6 Region: 2771-2879
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-29
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 1096-1225
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 989-1107
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.00042
Further Details:      
 
Domain Number 9 Region: 2245-2351
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-26
Family Cadherin 0.00098
Further Details:      
 
Domain Number 10 Region: 785-896
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.00053
Further Details:      
 
Domain Number 11 Region: 884-998
Classification Level Classification E-value
Superfamily Cadherin-like 5e-26
Family Cadherin 0.0021
Further Details:      
 
Domain Number 12 Region: 106-233
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-25
Family Cadherin 0.0024
Further Details:      
 
Domain Number 13 Region: 1728-1848
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 14 Region: 2038-2145
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-24
Family Cadherin 0.0025
Further Details:      
 
Domain Number 15 Region: 2986-3094
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 16 Region: 1413-1523
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-24
Family Cadherin 0.00086
Further Details:      
 
Domain Number 17 Region: 428-527
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 3397-3516
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 19 Region: 1630-1734
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 20 Region: 2881-2992
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 21 Region: 679-791
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 22 Region: 2145-2252
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 23 Region: 1836-1962
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-21
Family Cadherin 0.0031
Further Details:      
 
Domain Number 24 Region: 2553-2663
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 25 Region: 2449-2566
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-20
Family Cadherin 0.0032
Further Details:      
 
Domain Number 26 Region: 2353-2461
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 27 Region: 1326-1425
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-18
Family Cadherin 0.0066
Further Details:      
 
Domain Number 28 Region: 531-633
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 29 Region: 1947-2050
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-17
Family Cadherin 0.0035
Further Details:      
 
Domain Number 30 Region: 1202-1315
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-17
Family Cadherin 0.0036
Further Details:      
 
Domain Number 31 Region: 2670-2778
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000557
Family Cadherin 0.0038
Further Details:      
 
Domain Number 32 Region: 336-422
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000004
Family Cadherin 0.0035
Further Details:      
 
Domain Number 33 Region: 3-118
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000528
Family Cadherin 0.0058
Further Details:      
 
Domain Number 34 Region: 3510-3600
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000011
Family Cadherin 0.0099
Further Details:      
 
Domain Number 35 Region: 4009-4136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000133
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 36 Region: 3984-4021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000718
Family EGF-type module 0.01
Further Details:      
 
Domain Number 37 Region: 242-324
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000742
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301623209|gb|XP_002940912|
Sequence length 4570
Comment PREDICTED: protocadherin Fat 1-like isoform 2 [Xenopus (Silurana) tropicalis]
Sequence
mqftqysynatvyensaaktyvghptkmgiylkdpswdikykiisgdnenifkaeehnlg
dfcflrirtkggntailnrevkdnylltvkaveknsnaeartrirvqvldtndlrplfsp
tsysvslpentairssiakvtatdadigtngefyysfkertdmfaihptsgtivltgrld
ytetkhyemeilavdrglklygssgissmarlniyveqanehapvisavrlthpeldkdl
tyaivtvddndqgpngeiaslsiiagdplqlfkttrtspgskeykivavketewemqpfg
ynltlqakdkgsppqfsatkvihltssrfkygavkfekdiyrteisefappntpvvlvka
vpsnshikyafrnsadknrfsinpntglistlspvkakilshieldiitsdkkaftkvli
kvlgtnintpeftqtsykavvdenspigssvfsvhavdhdegengfitysianinpqpfa
idafsgvittledldyelmpriytlkirasdwglpyrreteipvtitlnnlndniplfek
vncegtvpkdlgvgeqittvsaidadelqlvkyriesgdeldlftlnpnsgvlslkqpls
egpankvsfyslritatdgenlaqpiyinitvtssrkgvhlnceetgvakmlaerllqan
klfnrgtqeevyfdshmtnthaphfksilpsiiaikenvpvganiihmeandldagfsgk
llyaisggnddscfavdmetgwlkilspldrelkdqynlnitvydlgipqksswrlldvn
vldvndnppeflqesysvhlkeneeghnaiiqvqavdkdlgvngevkysiltdtdiftin
setgvikavapldrekqhthllkieardqaenepqlfshvllkvtvedvndnppvfipsn
yhvkvredlpvgtvitwldaydpdvglsgqvrfsllengdgkfevdkvsgavriiqeldf
eekqvynltarakdrgkpvslssacyinvelidvnenlhtplfsefvskgsiredvpigt
pvmtvsahdedtgrdgeirysirdgsgvgvftiheekgtirtadnldrettshywltvya
tdrgvvplssfiqiyieiedvndnapqtvepvyypevmensakdvsvvqinafdpdsiss
dkltykistgnpqgffainpktglitttsrkldreqqsehilevtitdnghpaksavtrv
ivkvldendnkpqflqkfykirlperekperernakrdpiyrvvavdkddganaeisysi
eegdehgkffiepktgvvsskkssaageydilsikavdngrpqkssttrlhiewiakpap
saepitfeepsfsfsvmesdpvahmigvitteplgsplwfditggnydsrfdvdkgtgti
ivarpldaeqksnynltveatdgtrsvstqvsikvidtndhrpefstskyevlipedvqp
dteilqviaidrdeknkliytlqsstdpvslkkfrmdpatgslyttekldhetmqqhilt
vmvrdqdvpvlrnfarivinvtdtndhapwftssfyegrvyesaavgsavlqvsaldkdk
gknaevgysiesgntanaftidpvlgiiktakeldrnnhgryelvvkatdhgipplsqit
sihifvtisnnaapkftkkeysseisetahvgsfvamlsaysqssvvyeirdgntlnsfd
inpnsgvvttqkqldfetlpsftltvqatnmaglstnstltvhvrdendnfpvfaqtnyr
glisesappnsvvltddniplviratdsdqesnallvyqivepsvhkyfaidsstgalrt
llsldyeqtnifhftvqvhdmgyprlfaenaanvtiyvvdindcapvfskdvyetslllp
tykgvrvitvnatdddsgaysqliysiiegnigdkflidplkgtitvqnttnlrsryelt
irasdgrfssltsvkinvkeskesslkftqrsysatvlenatkvktltiisplgsrinep
lffhilnpdprfkisptsgvlsttgipfdreeedlfelvvevsdeqkpptvahvlvqvtv
edvndnnpvfvnlpyyamvqidapeghlirhvtavdrdigkngeityylkehsqqfqigp
sgeiklkkqfdpdssnkeyfitvvakdsgnpsyssevvvpitvmnkampvfenpfysaei
aenanlhspvvhvqanspegyriiysitdgdpfnqfninfntgvinvfapldfeshpayk
lrvratdsltgahaevfvdiiledvndnppvfrektyaatlseasvigtsvvqinakdpd
sgqnnaisfhlvetsgnisqyfhidassglietakpldyeyfqectlvvratdngippls
ndisvhigltdlndnppafiqqvyevkiselskpghfvtcvkatdadssdtekleysils
gnddmnfiinsktgvitvsylrkmilnpfysinvsvsdgvfrssaqvhvtvksanlhspk
fgqneyevelsenspvqtlvtelkavdedkglygqltyhiindfakdnfninergqlfta
erfdreiptnkvipvsvmakdtggkvgfcivnviltdsndnvpqfrateykvsiasdvpr
gtpivkviasdsdeganadifysieaqsasveenfgisqssgtiitkesligledevysf
fvkatdggtpqkeslvpvfirilppevvlpkfsepfytlsisedtavgteldvvkaesne
piiyslmkgntlesnlddvfvidkqngrlklekqldhestkwyqfyvlahnlhgeheiis
svdvsilvkdvndnapvfdsnpykafivenlpegtkvvqvrafdldvgsngqvsymlghs
qdleeikelfsvdretgwvttlgeldhektnkyhivvvaydhgdkvlsssstievtvmdv
ndnpprftaeiykgtvseddppdgviailsttdndteeinkevtfhitggdplgqfaien
mqhewkvyvrkpldrevkdnyllnitatdgtfatkavvevkvldandntpvcektsyaet
isedalagrvilqvaasdadirsnaeiiytlhgvgaekfhlnpftgelktslpldreile
vyhlmvkatdgggrfcqaaveltledvndnapefsadpytvtvyentepqtpllrvqaid
adlglnhkvqyslvssaegqfsidelsgiislekpldrelqavytltvkatdqglprkls
svasvvvsvldindnppvfehreygssltedapvgtevlqvyatsrdievnaeitykiis
gnehgkftinpvtgmifiiasldyetspeyyltveatdggtpplsdvasvninvtdvndn
spvfsqntyttvvgedsvsgqsvlmvvaddadgplnnhirysitegnpgntfiidpvrge
vkvnklldrelisgytltiqaedngqpprrntttvnidvsdvndnppmfskgnysiviqe
nkpvgfsilhlavtdkdsshngppftfvflsgnedntfqmdeqglittagtlsrkikdlf
vlhiqvsdngkpqlssftnievrvieesihppailpleiyittfgeeysggvigkvhatd
qdvydtltysldpkmenlfsvsktggkliarkqldvgqyllnvsvsdgkfttaaditvhi
rqitqellnhsitfrfanlspeefigdywrnfqrslrnhlggrkidiqiislqpsepprn
ldvllaaekvgntyfapkvliqkinasiaeiedisgvkildvfhklcldvecplrfcdek
isvdesvmsthstarlsfvtprhhrraiclckggkcptldslcdgntcpegtecvvdvke
gkfncvcpsdrpgqcnvgssvtftgnsyikyrlmenenkeemklslklrtysahavvmya
rgtdysileiqggklqykfdcgsgpgivsvqsihvndgqwhtvslevdgnyarlvldrvh
tasgtapgtlrtlnldnhvffgghmrqqgskhgrnlqvtngfrgcmdavllngqelplns
ksknnvhieesvdissgcslsaadvcsgspcqnggtcsplsnggyyckcsslfmgthcdi
sinpcasnpclyggtcivvkedfmchcrgdytgprcqfgpyckdnpcknsgkcidsldgp
vcecesgfhgdkclndideclenpcptgamcentygsyscncsngyggklctdvlpnkyv
stswniglaevigiivfiagtfsivvifvvcrtvankkkkkrqsepedkhsgatsaflpr
qfldpkvnkniysdippqvpvrpisytpsipsdsrnnldrnsfegstipehpefstfnpd
svhghrkavavcsvapnlpppppsnspsdsdsiqkpswdydydakvdldpclskksldek
achlynpresmseiqslssfqsescddnesfavpevrnsrgyhwdtsdwmpsvqlpdiqe
yphyevveepaphytdpnvidtdyypggydiendfppppddfplpdelpplppeyteqyd
smqpsrempvvgslgsstkssprynlnkylprhqyptsmsepqsttsgdgnsyrepyaas
ymlgfnrdfevpivdnmsmsgytsaasctdvsagcemesevmmsdyesgddghfedvtip
pldsqhhtev
Download sequence
Identical sequences gi|301623209|gb|XP_002940912|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]