SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623653|gb|XP_002941130| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623653|gb|XP_002941130|
Domain Number 1 Region: 1063-1150
Classification Level Classification E-value
Superfamily Immunoglobulin 5.45e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 862-945
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 699-757
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 4 Region: 981-1059
Classification Level Classification E-value
Superfamily Immunoglobulin 7.25e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 303-361
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 27-80
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000706
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 7 Region: 367-425
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000111
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 509-565
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 454-504
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301623653|gb|XP_002941130|
Sequence length 1201
Comment PREDICTED: papilin-like [Xenopus (Silurana) tropicalis]
Sequence
mkiplllaiftimlkpafllrrpkrqsdfwdnwgewkecsrtcgggvsfrerqcysrrad
ggsncigptknyrscnvqecpdgsrdiraeqcseydgmefqgkrykwlpyygasnkceln
cipkgenfyyrhkmavldgtpcepgrrdiciegvcktvgcdnildsskkedmclvcggdg
rscyevkgqyespvlskgysqlfiipsgatsiqikevlatrnflaiknirgeyylngywt
iefsralhvastvlhyyraaegdlapevitargptteplvveligqepnqgvqyeyylpn
qantddyqwsysswsdcsaecgggyqtrlvfctidseaypdimckekpspsrnrtcnsqp
cpqmkrwkinewgpcsatcgggtqsrsvycvtyegrasqqvvpdaecaaftekpasqevc
nlracakwslgpwteveffsfscnfvlgrdvssgsvhdcstecgegiqkrtvscttdsga
vvqdiaclmqmkppdtqlcygencvqeigwhigewglcskscnngirkrqvicadndrnf
yepetcevhepekpsviescnmqpcylqqqvasmqdtwgydnsdqfsltrynqqgstqnh
rpvnrnnrnednsipnyprdcrqnrfgccpdgvteaqgynhegcpqnhadanvgrnerad
pspgipseecrasqfgccfdninkatgpvgegcrskpsypypticllpsatgscadwstr
wyfvpevgkcnrfwygnchgnknnfateqecmsscqqiqgrnsgnveyryrkggmkwdrm
thihsgapgedvpveerrdhnqgmvktldqdlegrhlaghshgesstshirngditerhk
tktdtntsqhssvysiildkvkfssmetirgqtahlpcqvsdypfsniewqkdgqallps
skyiynpdgslvinrvhsedageykclassgsrreshrvrlqvkdlgaqgaqrvnasqat
kdtrnqplhsdrrgsaktplvidaslghrtrlpcllevhsstnvewqkdgkplssprhrk
qsdgsltisrmspddagiytctattragqvvkyiqlnirgelkitgpptsltvsegekae
lrcvvsgqnaniqwsrnglpvrsdwhhthvsedgtliirntkaadegsytcnayngahsv
sasadirvhksrptapplkllerhgecidhpdlancdlvvyanlcsneyynsfccascsr
h
Download sequence
Identical sequences gi|301623653|gb|XP_002941130|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]