SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623808|gb|XP_002941205| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623808|gb|XP_002941205|
Domain Number 1 Region: 764-905
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00034
Further Details:      
 
Domain Number 2 Region: 439-596
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-41
Family Retroviral integrase, catalytic domain 0.0077
Further Details:      
 
Domain Number 3 Region: 1440-1619
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.04e-35
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 1626-1830
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-28
Family Laminin G-like module 0.0083
Further Details:      
 
Domain Number 5 Region: 996-1177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-25
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 6 Region: 911-1024
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-16
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 7 Region: 279-314
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000795
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 
Domain Number 8 Region: 1236-1284
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000013
Family Fibrinogen C-terminal domain-like 0.0038
Further Details:      
 
Domain Number 9 Region: 1207-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000002
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  gi|301623808|gb|XP_002941205|
Domain Number - Region: 705-755
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0632
Family Chromo domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301623808|gb|XP_002941205|
Sequence length 1966
Comment PREDICTED: contactin-associated protein-like 4-like [Xenopus (Silurana) tropicalis]
Sequence
mepshaaptgslenvleallkrlefqeaqqahlssslqhfatrldslqgaqggsasppqv
pvsvapsavvqhsepkisapmryagdpevcrgflnqcliqfelsparfpsekskvayiia
llqgkalawasplwerddplvhnssafiatfreifdapgrkinastrllkitqgslsaae
yaidfrtlaaevawnndalvaafwqglnegikdelaardlptqfeqlvslviridsrike
rqsqksrvrrppvssvllpessstpsllaeepmqlgatrlspeertrrrsaglcfycgqs
ghilkacplkpqqpgsknvkadalsrslsseespsvppcsiippervvapislalpatea
tpvcppgktlvpqakisqilwwghsskiaghpgvkktldlisryfwwsslvkdvhqfvsa
csvcarqkvprclpcglhplpvpsqpwtdismdfivdlprsaefttilvvvdrfykmahf
vplrklpsavllasifikeifrlhgfpssivsdrgvqfvsrfwrafckllgiglnfssay
hpqsngqtertnqvleqflrcfisqnhdnwaellpwaefahhnlqhealgsspfacvygr
nplslppsvlkvdvpaaeaavhdfksvwssahqalakaalrqkkaadkrrrpapcfsvgd
svwlsskniklhvpcpklgpryigpfkvkevinpvcvklelppsmnisnsfhvsllkpvv
cnafssaspsptpvlvdgrqefevqeivdsrknrddcdgqltsslpqshfsssselsssh
sagfarlnrrdgaggwsplssnkyqwlqidlgerseitgiatqgkygssdwvtsyvlmfs
dtgrnwkqyhqeesisefigntnadsvvhhklqnhiiarflriapvnwnsygrigmrvem
ygcayrnaqfhpstphvnvslgsllddqqwhsviierfsrqvnfsvdrhvlhffmkgdty
hldidyelsfggiplkgksvsllqknfhgcfenlyyngvniidlakrykpqiyivgnisy
scvepetvpvtflnsnsflalrglqqdglavhfqfrtwnkdgtlfsyklgpesldlvlym
tdgkfkmslfkhgrsqsntatgfdlnnghwhslsfvgkrnrlivtidnqetlslqtalpi
qlgsghyyyfggcpdnntdhgcfspvksflgcvklisigsnlidiisiqqgkfgnftdlq
fdicgiidrclpnycehrgqcsqtwndfycncsetgytgatchysiyeksceaykhkgnt
sgfflidpdgsgplepfavycnmldtavavishnntdmnkvknsnkenphvmnfkyfadl
aqlqattdnaehckqelayhckksrilhkqshipyswwvgrtnetqtywsgsspdvskct
cgieencidsqlycncdadksewsndtgflsykdhlpvtkivitdtdrpqseaayklgpl
lcwgdrsfwnsasfntvssylhfptlhgeisadvsfffktsspsglflenlgikdfirie
lqsptevvfsfdvgngpfgvtvqspsnlndnqwhfikaernikeaslqvdqlpqktiitp
sdghirlqlnsqlyiggtasrqkgflgciryltlngialdleerakvtpgikpgcpghcs
sygnlchnggkceekhngflcdcnssayggpfckkeisayfgggssatltfpenytisrn
aswyssaqhpdtnsreniafsfrttqspslllfvssfnkqyisiiiakngslqirykleh
hldpdvfnintknlvdghlqkvrilrkgetlfievnqytavkfsltsvtefkavqflilg
kilendeldletmkanangfigclssmhfnhifplktvlyhekspqvittghitesscgs
vngidsassesthtfadhsrpkderepianairsdsaviggvisvvtfillcitaiairi
ylqkntykkneakasenedntdttaalkteismqntinesqkeyff
Download sequence
Identical sequences gi|301623808|gb|XP_002941205|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]