SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623915|gb|XP_002941259| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623915|gb|XP_002941259|
Domain Number 1 Region: 214-484
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-70
Family Eukaryotic proteases 0.0000101
Further Details:      
 
Domain Number 2 Region: 25-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-28
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 3 Region: 152-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301623915|gb|XP_002941259|
Sequence length 486
Comment PREDICTED: complement C1r-A subcomponent [Xenopus (Silurana) tropicalis]
Sequence
mwkqrqrpystmwryvvlllgtvscsqtsnnsplsgtitspnypklyprfndstwdiivp
egyyvslnfsvfdiepsencshgfvkvmadgkelgqfcgpvnssshpgnrqfvslgnqmr
ihfqsnfskemdgdiiqykgfqafyqaivvtcedppvltngqytfltapgrlgyrsaiqy
qcnapyynmvtpngsdtytcsaqrewrdehggnriprcrpvcgkpgdpvgsfgrilhgkk
adpgnfpwqvyvsrygtaggaligeqwvltaaqvlpddkekqdladvhvymgsvemkhlk
elgthpveafymhpnfnrnnydndialirlknpivmnqnvspiclpspqdeddiyqkdri
gyvsgygvnenrdipnelryvsvpmasrqdcktylnkkrpirnpsheerylfsrnmfcag
fpegslnkgdscrgdsggayttqnkqdtwvatglvswgfgcgqgygfytkvsnyvewiks
yvgedi
Download sequence
Identical sequences gi|301623915|gb|XP_002941259|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]