SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623917|gb|XP_002941260| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623917|gb|XP_002941260|
Domain Number 1 Region: 443-724
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.36e-69
Family Eukaryotic proteases 0.00000978
Further Details:      
 
Domain Number 2 Region: 212-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-27
Family Spermadhesin, CUB domain 0.0000374
Further Details:      
 
Domain Number 3 Region: 48-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-26
Family Spermadhesin, CUB domain 0.00011
Further Details:      
 
Domain Number 4 Region: 395-470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 5 Region: 328-398
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000162
Family Complement control module/SCR domain 0.00043
Further Details:      
 
Domain Number 6 Region: 160-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301623917|gb|XP_002941260|
Sequence length 726
Comment PREDICTED: complement C1r-A subcomponent-like [Xenopus (Silurana) tropicalis]
Sequence
mqlllalygchcevaerilfpcssyrwrwvvlllgslassqsnddrplfgnvtspnypkl
yprsnestwditvpegyhvslsfsefdiepsencsygfvkvmadgkelgqfcspvnsssh
pgnrqfvslgnqmrlhfqsnfskemdgdviqykgfqafyqaidkdecasptdnsatwtpp
cehncqnyvggylcscfpgynlqrdkrsckvecssemlteesgfisspgypepyppdlkc
nysirleeglqislrfqepfeidhhpkahcpydilkvfagdtmlnsfcgsrspgtvvtrs
htvdivfetgnagnskgwslhytsegnscpspeprdtytiispkqniyrmrdyidvtcqt
gyklikdgkvlssfsticlkggwnlpiprceivtcedppvltngqytfltapgrlgyras
ikyqcnapyyymvtptgsdtytcsaqgewrdeyggvkiprcrpvcgkpdnpvasyerilh
gknaapgnfpwqvyisingraggaligerwvltaaqvlhndnedtnptyvhvfmgsvqvk
hllemgphpveafyvhpnfrsydndialirlknpvvmnqnvspiclpspqdeddiyqkdr
igyvsgygvtekrniakelryvsvpvasrqdcetyldrkkqenpkyrekyplsrnmfcag
fpegslnkgdscsgdsggayttqnkqdtwvatglvswgfdcgrgygfytkvsnyvewiks
yiekde
Download sequence
Identical sequences gi|301623917|gb|XP_002941260|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]