SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301624268|gb|XP_002941427| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301624268|gb|XP_002941427|
Domain Number 1 Region: 206-439
Classification Level Classification E-value
Superfamily Kelch motif 1.02e-41
Family Kelch motif 0.0005
Further Details:      
 
Domain Number 2 Region: 7-69,101-126
Classification Level Classification E-value
Superfamily POZ domain 0.000000000541
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301624268|gb|XP_002941427|
Sequence length 485
Comment PREDICTED: kelch domain-containing protein 5-like [Xenopus (Silurana) tropicalis]
Sequence
mssvetvqillgsrcysvpreqlvaqsgffqslfrsgmreshgepvtlhgltpeglegvl
rhitggslleaqggsefgfqvvsledpercsledestcglessgplqavveaasylqvqg
llsllqssmsldtcldilevaqlhgqwdlasaalhfmaahylsmlrredfqqsprslrtr
vleerlrgtpalmvlsqqgpdnwvllryleggggwqvmtgevpqsmlrvqgygattlhny
lfvaggrrdngqeisavhsynpsngcwtqepsmnqkrcnfrllavggalyavggqtlpnv
ecyipaqdawtpvsplpeilaefsacesrgniyvvggytprgrnlnilrycpsadewcvf
dvcqqhvrkqqmvsleetiflvggcvrnvksgqtedslgihsyntrtktwnclkantsks
glsvscalhndgiyilsrdmgptmgarnriflkycvftggieyvrgppsegnnmqlcsly
lpqal
Download sequence
Identical sequences XP_012815105.1.99540 XP_017948279.1.99540 XP_017948280.1.99540 XP_017948281.1.99540 XP_017948282.1.99540 XP_017948283.1.99540 XP_017948284.1.99540 gi|301624268|gb|XP_002941427|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]