SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301624403|gb|XP_002941495| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301624403|gb|XP_002941495|
Domain Number 1 Region: 386-488
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Weak hits

Sequence:  gi|301624403|gb|XP_002941495|
Domain Number - Region: 64-109
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.022
Family MED7 hinge region 0.0093
Further Details:      
 
Domain Number - Region: 181-281
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0915
Family A middle domain of Talin 1 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301624403|gb|XP_002941495|
Sequence length 490
Comment PREDICTED: scavenger receptor class A member 5-like [Xenopus (Silurana) tropicalis]
Sequence
mdnkamylhsfdekengsafeepfdgrnlskmnlcdgcpsgkrrssrrcgqlgsiaalky
avvglyllvflilvgvfilavsrpqsspedlkvltgnmnrlnesyrdlqfklmqlsfkgd
fmehvwklqdlfqnhsdsllqlteslhkleenlqllqdmatktdtittnlganlnqlsds
hqseiyrlstefnssrymwnhhdtllkemsskvegfnyqiseilgtlnavnatftydigi
hhtriqdlqglvtnvseetrhmrllhivmeqqlkhemallnnvtedlrlkdwehsialkn
itlirgppgpkgeqghegmegepgapglpvfegipgapgpvglpglkgdqgdiggrgimg
lrgfngnktprltallggfpgaveesavrlvngsgphegrvevfydkrwgtvcddgwdkk
dgdvvcrmlgfkgaeevyrtarfgqgvgriwmddvackgteesilqcsfsnwgktncgha
edagvtcikq
Download sequence
Identical sequences gi|301624403|gb|XP_002941495|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]