SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301624607|gb|XP_002941592| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301624607|gb|XP_002941592|
Domain Number 1 Region: 1268-1356,1385-1606
Classification Level Classification E-value
Superfamily NHL repeat 1.23e-23
Family NHL repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 1503-1552,1579-1754
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000863
Family Quinohemoprotein amine dehydrogenase B chain 0.081
Further Details:      
 
Domain Number 3 Region: 963-1033
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000294
Family Pre-dockerin domain 0.04
Further Details:      
 
Domain Number 4 Region: 672-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000388
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  gi|301624607|gb|XP_002941592|
Domain Number - Region: 802-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000152
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 772-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 705-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 839-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 638-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00472
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 609-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0312
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301624607|gb|XP_002941592|
Sequence length 2808
Comment PREDICTED: LOW QUALITY PROTEIN: teneurin-4-like [Xenopus (Silurana) tropicalis]
Sequence
mdvkerkpyrsltrrrdterrytsssadsddskvpqksysssetlkaydqdsrltysnrv
kdmvhqeidefcrsggsftlhelglgevspphgtlyrtdlglphcgysmtsdndadtepd
avlspehpvrlwarstksgrssclssransnltltdtehentengpplhcssassspieq
tpspppspaanecqrrllgssvapaaaaaaaqdsdsegdfvpnsflvksdsanlavpand
qplvlqnhlrtkppppplshpqiphhaasinslnrgnytprsnpspaptdhslsgeppgg
gqeaihaqdnwllnsnipletrhflfkpggtsplfcttspgypltsstvysppprplprs
tfsrpafnlkkpykycnwkcaalsaiiisvtlvillayfiamhlfglnwhlqpaegqmye
itedrgnswpvptdvtlypsggtglelperkgkgtsegkpnslfpeetfidsgeldvgrr
atqkippgifwrsqvfidhpvhlkfnvslgkaalvgiygrrglppshtqfdfvelldgrr
llvqearglevpqrlhrviaplsshetgfiqyldsgiwhlafyndgketevvsflttaie
svddcpsncygngecvagnchcflgflgpdcgrascpvlcsgngqymkgrclchsgwkga
ecdvptsqciditcsnhgtcimgtcicnpgykgenceevdcidptcsgrgvcvrgechca
igwggascenpratcldqcsghgtyqtetgvcscdpnwtghdcsteicaadcgghgmcig
gscrcdegwmgtacdqrachprcnehgtcrdgkcecspgwngehctiahyldkvvkegcp
glcngngrctldlngwhcvcqvgwrgsgcdismetacndgkdndadglvdcmdpdcclqh
scqtsslclgspdpldiiqetqapvphqnlqsfynrvkfligkdsthyipgenpfnrgha
cvirgqvitsdgtplvgvnisfvglsafgytisrqdgsfdlvtnggvsitlrferapfit
qehtlwlpwdrffvmetitmrheeneipscdlssfarpnpvlspapltafasscsakgpi
vpeiqalqeeipipgskirlsylssrnagyksvlrislthptipfnlmkvhlmvavegrl
frkwfsaapdlsyffiwdktdvysqkvyglseafvsvgyeyescpdlilwekrtavlqgy
eiessklggwsldkhhalniqsgilhkgngenqfisqqppvigstmgngrrrsiscpscn
gladgnkllapvaltcgpdgsiyvgdfnfirrifpsgnvtsilelrnkefrhshspahky
ylatdpitgaillsdtnsrrvykikstnvvkefaknseviagtgdqclpfddtrcgdggk
aieaslnnprgitvdkfgliyfvdgtmirridqngiistllgsndltsarplscdsvmdi
sqvrlewptdlavnpmdnslyvldnnvvlqisenhqvrivagrpmhcqvpgidhfllskv
aihatleaavalavshngilyisetdekkinrirqvttngeislvagapsgcdckndanc
ecfsgddgyakdaklnspsslavcadgelyvadlgnirirfirtnkpflnsqnmyevssp
idqelylfdttgrhlytqslttgdylynftytgegdltlitdnngntlnvrrdstgmplw
lvvpdgqvywltigtnsalksvsaqghelammtyhgnsgllatksnedgwttfyeydtfg
rltnvtfptgqvssfrgdtdssvhvqmetsnkedvtittnlsasgafytllqdqvrnsyy
igadgslrlilangmevalqtephllagtvnptvgkrnvtlpidnglnlvewrqrkeqar
gqvtvfgrrlrvhnrnllsldfdrvtrtekiyddhrkftlrilydqagrpslwspssrln
gvnvtyspgghvagiqrgtmsermeydqtgriisrtfadgktwgytyleksmvlllhsqr
qyifefdkndrlssvtmpnvarqtmetvrsigyyrniyrphegnasviqdfseegqllqt
lhmgtgrriiykygklsklaeilydttriafsydetagmlkainlqnegftciiryrqig
plidrqifrfteegmvnarfdynydnsfrvtsmqavinetplpidlyryddvsgkteqfg
kfgviyydinqiittavmthtkhfdtygrvkevqyeifrslmywmtvqydnmgrvvkkel
kvgpyanttrysyeydsdgqlqtvsindkplwrysydlngnlhllspgnsarltplrydl
rdritrlgdvqyrmdedgflrqrggdvfeyssagllvkaynkaagwsvryrydglgrrvs
rktnlghhlqffyadlanptrvthfynhssseiaslyydlqghlfamelssgdefyiacd
nigtplavfsgtglmikqilytaygeiyldsnpgfqiiigyhgglydpltklihmgrrey
dvlagrwtspdhdiwkrlsttnvmpfnlymfknnnpvsnaqdtkcymtdvnswlltfgfq
lhnvipgypkpdidamepsyelintqmktqewdnsksilgvqcevqkqlkafvtlerfgq
iysstiagchlesenrkfatlgsifgkgvkfamkdgrvttdiisvanedgrriaailnna
qylenlhfttdgidthyfikqgpsendlsilgltggrrtlengvnvtvsqintvlgartr
rytdiqlqygtlclntrygttldeekvrvlelsrqravtqawqreqqrlrdgeegtrvwt
egekqqllntgrvqgydgyfvisveqypelsdsannihfmrqsemgrr
Download sequence
Identical sequences gi|301624607|gb|XP_002941592|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]