SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301625229|gb|XP_002941813| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301625229|gb|XP_002941813|
Domain Number 1 Region: 59-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000428
Family EGF-type module 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301625229|gb|XP_002941813|
Sequence length 170
Comment PREDICTED: probetacellulin-like [Xenopus (Silurana) tropicalis]
Sequence
mdtltlskhlllplflgftvlpyvstdgnstehpettsppcpqytddctelssqskwngh
fsrcprtyrhycikgkcrfvtaesipacicdlgytgarceyldlfylkgdrrhyvvigli
vammfliilivgicicthhwqraqrrkrkekereglnndsatkveethfv
Download sequence
Identical sequences gi|301625229|gb|XP_002941813| XP_002941813.1.99540 XP_017951885.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]