SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301625476|gb|XP_002941932| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301625476|gb|XP_002941932|
Domain Number 1 Region: 20-126
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 172-278
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 505-613
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 4 Region: 407-470
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301625476|gb|XP_002941932|
Sequence length 623
Comment PREDICTED: deleted in malignant brain tumors 1 protein-like [Xenopus (Silurana) tropicalis]
Sequence
mafllpvvfvmfhglssagilnvrlsdgpdrctgrveifvhnewgticdddwdmadaavv
crelscgtairappaaafgfgkgkiwldnvkcrgdesllhqcnhkkigahdcdhkedasv
vcsgsktlldlfedservstesleptpmsspaptepivslkqmsaraadhiepgsirlvn
gggrcagrveiyyngtwgtvcddlwnmssarvvcrqlhcgepisanikaffgvgkgviwl
dnvrcigsentlrdcnshwwgkhdcvhdedagvvcsdhlsgvasiynedtvkttktskpv
qpvsgspdksphlspespqhspvdplsgaasiynedtakttktskpvqpasgtpdkshhl
spespqhspvdhlnedplqsllgklntsdqlstspmtspphslnatepgsirlvngggrc
egrveiyyngtwgtvcddlwnmnnarvvcrqlhcgepkdakikaffgsdhlnedplqpll
gklntsdqlsispvmspphslnatepgsirlvngsgrcegrveiyyngtwgtvcddlwnm
nnarvvcrqlhcgepiagkikaffgsgeeriwmdnvecdgsenalndcnfhewglhdcsh
dedagvvcsgqsficfyvtgnvf
Download sequence
Identical sequences gi|301625476|gb|XP_002941932|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]