SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301626452|gb|XP_002942405| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301626452|gb|XP_002942405|
Domain Number 1 Region: 25-214
Classification Level Classification E-value
Superfamily vWA-like 5.7e-61
Family Integrin A (or I) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 830-1015
Classification Level Classification E-value
Superfamily vWA-like 3.4e-52
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 3 Region: 1014-1200
Classification Level Classification E-value
Superfamily vWA-like 4.97e-52
Family Integrin A (or I) domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1394-1578
Classification Level Classification E-value
Superfamily vWA-like 2.88e-51
Family Integrin A (or I) domain 0.00026
Further Details:      
 
Domain Number 5 Region: 616-814
Classification Level Classification E-value
Superfamily vWA-like 1.15e-50
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 6 Region: 226-415
Classification Level Classification E-value
Superfamily vWA-like 2.78e-48
Family Integrin A (or I) domain 0.00048
Further Details:      
 
Domain Number 7 Region: 1199-1392
Classification Level Classification E-value
Superfamily vWA-like 1.48e-45
Family Integrin A (or I) domain 0.00053
Further Details:      
 
Domain Number 8 Region: 429-607
Classification Level Classification E-value
Superfamily vWA-like 1.83e-43
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 9 Region: 2100-2284
Classification Level Classification E-value
Superfamily vWA-like 7.09e-32
Family Integrin A (or I) domain 0.0039
Further Details:      
 
Domain Number 10 Region: 2343-2523
Classification Level Classification E-value
Superfamily vWA-like 5.04e-25
Family Integrin A (or I) domain 0.0039
Further Details:      
 
Domain Number 11 Region: 2558-2614
Classification Level Classification E-value
Superfamily BPTI-like 3.55e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00076
Further Details:      
 
Domain Number 12 Region: 1587-1776
Classification Level Classification E-value
Superfamily vWA-like 0.0000223
Family Integrin A (or I) domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301626452|gb|XP_002942405|
Sequence length 2615
Comment PREDICTED: collagen alpha-6(VI) chain-like [Xenopus (Silurana) tropicalis]
Sequence
mernrklirdtrenkpendrkllelcteasiadivflmdgswsigtenfitmknflytlv
ngfdvgldkiqigliqysdnartefflnsysnkedvlkyiqnlkykgggtktglslefml
tqhfseaagsraaegvpqiavvitdgqaqdsirepaiavknagiilyaigikdavlseln
eiasdpddkhvysvadfnalqsisqnmiqvlcttveeaarqtgqiaqvcrtanqadivll
vesttrmgdatfekaknflydlvsnldvginkiriglvtyndetnpefllnsysskteil
esiqnmkyvegytytgraleyvnttyftqaagsrfeesvaqiliivtegdssdtltepak
elksrgisvyvvgtnikydrqlqeasskpdekffyqlddfddsenvteqllknlcfsidl
niqvyskryadvvflvdsstsmgtiffqkmkdfiihiinqlnvginkhriglaqysglpq
tefllnhyetkeeilkhiketftyrggplktghalefvrstffieeagsrinygnpqflv
vitssksedavrrhaeelksvgvttisvgignsdrkelekiatdpfvfqttglqhisnlq
qdvanviiaedmlqfspvsvvpavcssasvadivflidesssigpinfqltrvflhkvvs
aldislsnvrvglvlysdeprlelklntfnekyeildfitklpyrggkahtgaaldflrk
kmftkqnggrphqgvqqiavvmtngqsmdnftkpaaklrrsgvevfavgfqnindteldi
iashpprkhvtnvesflqlsnlefriqkrlcneivvksfavpaiaravkegcvdteeadi
yflidgsgsiypedfedmkkfmielismfqvganrvrfgvvqysdvrrteffisehntqk
mlkdaisqieqlgggtltgealtsmkqlfvnaakdrphkvpqslvvitdgesqdrvteaa
aeirndgitifaigvknaveeeirdiagsnekmffvnnfdslkvikndlarelctpeack
nmkadivflvdssasinsddyetmkefmesmvkqaeigpdrvqigliqfssetkeefpln
rykrkdeiqsairgiqqlsqgtlmgealkytlpyfsaskggrvntkqylivitdgeaqda
vgnpakairdhgviiyaigvqqanntqlleiagkqeqvyyedsfdslaflnknimfeicn
pqesckktevadiiflldasasitrgefrlmqrfveavvndslvgkdnvqfgavvygtnp
aeqfslntystkldilkavfslpqvsgytytakaleytrirfgtsyggrpgishililvt
dgatteadrpnlpivskalkddgiivfavgvgkavpqelqqiagypdrwflvqnykgldn
ihdnitqvvcdeskpacsheqldlvflidgsasitssnftsaktfmkeivdsftisenrv
rigvaqysanpkkefflneyysssdmkkqidsisqlkattytgkglrfvkqffdpanggr
knvpqylivmtdgmsndsvnedaaalrssgvkifsigiglrnsfelvmiagspknvyeve
tfqaldsikrqivaqvcepsdqpiigkecslditisvdysrramlstvprvqqklqqflp
pvlqrisslsniscasgsqinlrfryavaaqdrltfdsdfekfnediikkfiaeqssvdt
ylnakflqslwnkyiglpsqkakiilvftdgldessevlkatteslrkqgldallfiale
gvkdftelqnlefgrgfsyqqplsialhdlpsvmlkemdtvaerkccnvvckclgqdgpl
gspgalgtkgqpgikgsqghpgeegghgergfrglngtrgesgcpgrrglkgargirgdk
gddgefgidgvpgeqgepggrgasgergdtgaqgrkgprgqpgekgenglrgdpgepgtn
iniqgpkglkgnpgrqgeagsdgvegepgnngpngpqgrrgppglkgargfpgepgnkgd
sgiqgiqgsqgmpgppgpqgpqglsgrqgdagapgasgsfgkpgapglkgepgengekge
pgipgrrglpgldgpdgygppglkgekghlgfpgdpgpqgedgdpgiagnggpkgisgrr
gakglpgtmpmtpcelvaftrencpcfasaskcpvypteivfaldasqdvppaafqrmkn
tiisiiekldisesncprgarvavvaynsntkylirfsdykrksllleairgispersss
rrnigeamkfvgrnifkrirhgihvrkvavffangpspdadainsavleysaldiipivi
afnnvpnvvaafsadetrrfqvfvwsrpedqrlelisyctlcydkctpdeeceldqmpat
lidmdiafvldsshnvqadvfeemkdfvssmldtvyistrpavsetearvalvqqavkdf
gpnrntspvktefdllrynsanmmkrhikqsvrqlngpsavgnsvqwvidniflktpmpr
khkvlflilasptsywdreklkevskkakcqgfaifvlgfgktiselemtqlpslpqdqh
llrlismskpelvyakkfshaffnlldrkkangevrslkkdvctmkqeegkcadyilkws
ynqgkkacvqfwyggcggngnrfdtqeqceatcms
Download sequence
Identical sequences gi|301626452|gb|XP_002942405|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]