SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301626947|gb|XP_002942647| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301626947|gb|XP_002942647|
Domain Number 1 Region: 1593-1840
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-56
Family Ankyrin repeat 0.000000232
Further Details:      
 
Domain Number 2 Region: 278-413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.005
Further Details:      
 
Domain Number 3 Region: 756-886
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 520-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000679
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 629-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000745
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 6 Region: 919-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000273
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 594-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000322
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 555-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.006
Further Details:      
 
Domain Number 9 Region: 883-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000447
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 1125-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000468
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 11 Region: 138-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 12 Region: 730-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 691-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 250-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000166
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 15 Region: 1038-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 16 Region: 957-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 175-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 18 Region: 441-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000692
Family EGF-type module 0.005
Further Details:      
 
Domain Number 19 Region: 1271-1302
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0022
Further Details:      
 
Domain Number 20 Region: 217-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 1078-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 22 Region: 1009-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000411
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 1158-1199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000712
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 24 Region: 51-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000612
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  gi|301626947|gb|XP_002942647|
Domain Number - Region: 477-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000532
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1199-1229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 22-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0898
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301626947|gb|XP_002942647|
Sequence length 2067
Comment PREDICTED: neurogenic locus notch homolog protein 3-like [Xenopus (Silurana) tropicalis]
Sequence
maarsgsslsvdglmlgldcqipcrnggvclslengtqicrcpdgedctyrdpclsvqck
nggscyrfsatdyrcqcetgwtgalmektalteilvyqfnaktgalaiasqlltivvsvk
ldgqltwmvsagknceyldfctpnrcknngkcinmvpsfrcqcpigfegescekdvdecq
aadtcrnggtcenlvgsfkcecpesyhgtrcemrrgvcaadsclnkgkcqqmefykyqcv
cptgytgskceeniddcinhrcenggsckdglgkytcqctpgwkgwycsndidecqtpgi
cknggtcqnipggykcvcvngwdgdncehniddcatatcaegatcidhvgtflcmcppgr
igyqgpqceddvdectsspcknggqchnqpgsyncscpggfqgsvcetdinecavllvts
vparitlasshatvtpgtlcdedinechsspclnggacnntqggflchcppgtiqplctl
qdnnctnvtcvhgncqkqnnrttcicdegwngsvcdtyiqcvtnpcqnggvcqpfqerfi
cscvsgytgssceldvnecekrpcknggrcvntpgahhciclpdytgtlcealvdpclsd
kcqnggtcvsetfsclcpagytgehceedidecvsspcqngascqnkansyicvcdegye
gekceintmdcttrttcicdegwngsvcdtyiqcvtnpcqnggvcqpfqerficscvsgy
tgpncetllspcysnpcsnggtchhypdqnviqcdcpagwqgssceldvnecekrpckng
grcvntpgahhciclpdytgtlcealvdpclsdkcqnggtcvsetfsclcpagytgehce
edidecvsspcqngascqnkansyicvcdegyegekceintmdcttssclnggtcvdgia
sfwclcperftgkhcqeelsrclsnpctnrgicqhipggyfcscpygytgancemavdfc
stapcqnggscsqsgisykchcasgwigshcetplhgcrarvsqdvettalcnghgtcvd
sghsyichcfpgytgslcevktgfcqpnpcqngahcqeqdgsflcqclpgflgqtcterd
pclsrpcfhngvcvaqggeykcqcpsgtqgihceinpddcatvssepkcfhggtcrdeig
gfscfcppgfvgkrcegdvneclsnpchpigteicvqlnnaykckchrlytgqkcdqpin
fcannpcfnggscavtantplgftcscpkcadfyefyyeeniytniltdeigikshylqi
tdvvtnnkdplynnycldhfanghcergcdnvecgwdggdcsneerkksegslilvlsya
ppvlhqreinallrnlsmliragirlqkdssgnmlfryrrsdsldelfpdrlqrweyevi
enpnlkdlkketmsredtigcvlflevfgaecvqppclhtsknvadfvtalsektepclp
ysllgvkykdapidptqmsatqlpwplvwasvavgaalvlggfigvqlsrkrqhgvlwlp
sgfsrhrsgegirrrepvgedatglrplkhdsvydvdlatdeeilqpkykrakvpeecsi
ldhrqwsqqhidagvrfpqcialtppqqeadcrdidvrgpdgvtplmsaicaggglepvg
ggadppevessavvisdlisqgaslnaqtdstgetalhlaarfsrqdavkcmldagadtn
vqdklgrtplhtaiaadalgvfqtllrcrqtdidarmndgstplilaarlpvqnmveelv
scgadlgaadtrgksalhwaaavnnaaavktllcngankdlqdkrdetplflaaregsle
atrillehqadrdlcdhtgrqprhiardrghrdiqklleercpavprntsvatpsagaqa
kkthrprtkehvkptplphidlstscypqapplsappyiqgpppdssccqshhslmsygg
ncqpyprsgsfssavpgcqwgnrgwrvhfcpsgctvseapysgggqpvsphahwlpeshh
pqspkcqsqpsgycpnpaleqtapkdlpctptdqfgnsiyltppssqygypspaspeets
qtqtcmhhhpfltpspesrnpwgvssp
Download sequence
Identical sequences gi|301626947|gb|XP_002942647|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]