SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301627002|gb|XP_002942671| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301627002|gb|XP_002942671|
Domain Number 1 Region: 3757-3961
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-38
Family Laminin G-like module 0.0005
Further Details:      
 
Domain Number 2 Region: 1512-1528,3413-3585
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.55e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 347-433
Classification Level Classification E-value
Superfamily Immunoglobulin 6.35e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 1827-1915
Classification Level Classification E-value
Superfamily Immunoglobulin 9.39e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 3242-3327
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-18
Family I set domains 0.0075
Further Details:      
 
Domain Number 6 Region: 3319-3407
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-18
Family I set domains 0.009
Further Details:      
 
Domain Number 7 Region: 2691-2775
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 1549-1642
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-18
Family I set domains 0.042
Further Details:      
 
Domain Number 9 Region: 3596-3696
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-17
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 10 Region: 2876-2963
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 2215-2299
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 12 Region: 2501-2599
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 13 Region: 2778-2864
Classification Level Classification E-value
Superfamily Immunoglobulin 3.74e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 14 Region: 2583-2683
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 15 Region: 2971-3062
Classification Level Classification E-value
Superfamily Immunoglobulin 7.95e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 16 Region: 1641-1728
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-17
Family I set domains 0.0000463
Further Details:      
 
Domain Number 17 Region: 1741-1822
Classification Level Classification E-value
Superfamily Immunoglobulin 9.74e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 18 Region: 2313-2399
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 19 Region: 3051-3143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000103
Family I set domains 0.035
Further Details:      
 
Domain Number 20 Region: 2022-2107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000418
Family I set domains 0.014
Further Details:      
 
Domain Number 21 Region: 1924-2009
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000495
Family I set domains 0.019
Further Details:      
 
Domain Number 22 Region: 2119-2202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000181
Family I set domains 0.027
Further Details:      
 
Domain Number 23 Region: 3159-3236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000197
Family I set domains 0.019
Further Details:      
 
Domain Number 24 Region: 2403-2489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000045
Family I set domains 0.038
Further Details:      
 
Domain Number 25 Region: 265-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 26 Region: 706-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000198
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 27 Region: 224-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 28 Region: 1434-1486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 29 Region: 125-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 30 Region: 309-351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 31 Region: 769-882,1066-1081
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000377
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 32 Region: 1493-1541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 33 Region: 3700-3743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family EGF-type module 0.012
Further Details:      
 
Domain Number 34 Region: 1094-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000847
Family Laminin-type module 0.044
Further Details:      
 
Weak hits

Sequence:  gi|301627002|gb|XP_002942671|
Domain Number - Region: 669-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 1398-1436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00439
Family Integrin beta EGF-like domains 0.075
Further Details:      
 
Domain Number - Region: 1155-1198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00725
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301627002|gb|XP_002942671|
Sequence length 3985
Comment PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein-like [Xenopus (Silurana) tropicalis]
Sequence
manvavaqyvlvyyralvnftqsieyspeldnvsspefidlseavvdtleseyhkipgeq
mvsvvyvkvidgdtfveldvgsegysndaeirqvlfsvidsrsiasyitsaqgfqfrrlg
svtpslrpcrddeftctsgdcvpaeyrcdhrhdcrdmsdeleceyevvvtvpqeprittp
gpnlgpvstarpattpprpftrppviattpykpfthkpppdletrqcrrdearcpngqci
prdylcdgekdckdgsdemhcgtpspcepnefkckngrcalklwrcdgdndcgdgsdeln
cptkgpsdtcapdqfvcvqartcipasyqcddeadcpdrsdevgcnppqvitppeesima
srgdtvrftcvaigvptpiitwrlnwghiptssrvsmtsenghgtliirdvkeadqgayt
ceainakgmvfgipdgvlilkphrgpcpegsfyvensarcipcfcfgvtkvcqqtgryrn
qirlrfdvpedfkgvnftvpshvgipplssnqlqidtsveefqlvdlsrrflsidsfwtl
pgqflgnkvdsyggslsfkvrygltrgqsepvrkpdvilvgngrkliyrvqtstqpsivn
qrkiqfteenwqhesgasvtredllmtlqnleaimiqtvydnkmasvgisdivmdttsve
ytqlgpavgveecrcpggyagpscevcaaqfervpggpflgtcsgcncnghasscdpvsg
yclncqhntegpqcnkckagffgdptrgvsdacrpcpcphtdprrrfsdtcfmdvdgqpt
cdscapgytgrrcercaegydgrpmqpggrcepvgnvcdvkgalstgdgscvckshvegn
fcnecksgtfylseknpdgclkcfcmgitrqcsssfwnrdqvsstydsqdrvpftisnag
strtlsesirvtgqseltfsnflnvpqdvyfwvlpdrfkgdkvtsyggelrytitfeapa
gsqplfgqpdvvlqgngiflehsantrtapgfpititvpfrerawrradgqdatrehllm
aladidllmirasyaermvetrisnihmdvavpyptdrqravevehcvcppgysgpscqv
caplallffasktgyfgtcfldrdghptcdscpvgyagrqcercapgyrgdpargqpcta
dggsscpcdlrgsvsdrcdsrrqceckpnvegascgtcrphhfylstenpdgclpcfcmg
vtqqctsstyhrelistpflpgnfqnfalvnrqrssritsgftvemsrhgpqlthssfdq
lgqesyywqlpegyqgdkvasyggklrytltynagirgsalpdadvqitgnditlvayqh
dlrpresksfeivfresswkrpdgqpatrehlmmaladldeilvrasystdmlsssitgv
smetagpsytnlpqaleveecrcppgyqglscqdcapgytrtggglylghcepcycnghs
eschpetgacsnclhntvgescdqcapgfygdasagtpedcqpcacpltnpdnqfsktce
ilgtsgyrctacqpgytgqycercapgytgnpnipgqkcvpegnrsklivrihpqkatls
pggevtlrchvsgnppyyfywtredgrpippsakavgegenlhfsrvqptdsgvyictcr
spesvntskaeivvsaapskpitvtveeqrvqtvrpgsdvtfictakskspaytlvwtrq
hnrklpdramdfngiltirrvqpedagiyvctgsnmydmdegnatlyvqasgtatspnaa
aeprqltvqrgqtaefrctatgtptpavewtggpngglspravvqggvlrfhsvepsdeg
qytcrvhnsagqhfarvdlrvhsgslpevqvspertevregdtvrlycraggtpaatisw
rkeggslppqartertdistlvipsisaadggtylcvgtssagsaqarieviviggrsns
pihgptlriepssdtviegqlvelncvsanpyatvtwhrgggrplspnhqaygsklrilq
astadsgeyicrvtngaatqqasiiititrssgpqqpsgnvpalriepssdtlvegqtle
lnclfpsypnavvtwhrsgqplspnhqvsgprlrilqasvadsgeyicrvttgpvtqkas
ilvtitrasgpsiplgngpavrietssgsvvegqtlelncvvagqpdavvtwhragrlls
pnhqvlgsrlritqasvadsgeyicrtttgtttrqgsimvtithstssghsslitptini
esapdsvaegqtvvlncviegrphqevtwyrpdqplapnhqvsgsrlrithasprdsgey
icriqsgagvqmasimvsiegsslntglgspiriesssetvelgqtielnclaeghpgav
vtwhrsgglplpsnhqvsgsrmrilqaspadsgiyicrvssasgsqeasvtinvhssaqv
pnqfpypilieksadtvsegqtldlncvvvgqpqapvswhrpgasfssnhqisgsrlriv
qastadsgqyvcrhdtgagiqqasisvsilsgaassyrlqspvisidphsatvqrgqnat
fkcrihdgaqpirvtwqmrhnqpmednvhispngsiitivgathknqgsyrcmasnaygm
vhssvnlvvqgrpsvsviphgkirvkegepinvecmgigdprpivswrrtgarenlkqhr
lapldgtavlqipsakpadsgsytcvahnphgstqvhvevhveghvispgaplvladkpv
hvvvtggqatlscsasgnptptitwsklraplpwqhqvvnntliipnvaqqdsgqyicna
snadghaevyvtldvetpayattlpheasvspgepiqiqclahgtppikfqwsrvdgtlp
gqasiqdgvlhidqasasdsgtyrcvasnkvgsseafaqvtvsgggaetgrptasiiprg
pvrvkvgspiylecmgqgdprpvvswrrtgdrqnlkpqqlvpldshavlqilsarpedsg
sytctaqnpsgstqvqvevhvegrvitpgvpkvtaeqplhvvvagdraslsctavgnpap
kitwsklraplpwqheivndtliipkaalqdsgqyicnasnaegysevfvtldvetppya
ttlpdevsvsvgeviqiqclahgtsplkfqwskvngslpdratvrdstlhinlakaadag
tyrcvvgnkvgssktfaqvsvlgkspfavrvsplidtkavsgtaeftctvvgdprariqw
skeggqlpaghqvqggvlripnlesgnegtytcrvssrfgqaqesvrlvlqalpkvrini
rtsvqtvlagnsvefeclalgdprakvtwskvgsrlpadavisggtlrieqvkqsdagqy
rctaandvgevqshvilhvqsvpqiaaqpemkeitagstavfpclasgfpvpditwskle
gdlpsdhqidnnvltilsvkpedagtyvctaanrqgrvtafsmlkvrervvpyftgqpqs
ylslpsikdahkkleikitfrpdtadgmlvysgqkksngadfvsfglvggrpefrfdags
gmatiryptaislgefhtvtlyrnltqgslvvdrhvpvngtsqgkfqgldlneelflggy
shydsisktglnsgfvgcvrqliiqgeevifkdldlsangvsncptcrdrpwlailrsle
pvtlgqwhkvsaervnkdgtlivdgtdpvkrsapgksqglnlktlmylggvdgsvelpsa
anisrhfqgcigevsingkkvdisysftessaigqcydnspcdrmpclhggrcqptgeye
yqclcldgfkgdrcethedqcqihnpclngatckdnrchcpsgysgticehgrtagaedr
dwpvegsggndapglygsffsddsyialpkhvfprsrpeapetieleirtsssegvilwq
gmeeneqgkgkdfislglkdghlvfsyqlgsgeanirsedpvndgewhrivavregklgs
iqidgedsvsgaspgrnimvntkgsvylggapnvktltggkfssgingciknlvilnarp
sqqphqpidlkhhaeaghntkecps
Download sequence
Identical sequences gi|301627002|gb|XP_002942671|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]