SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301627538|gb|XP_002942931| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301627538|gb|XP_002942931|
Domain Number 1 Region: 307-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000491
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 402-486
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000522
Family I set domains 0.0055
Further Details:      
 
Domain Number 3 Region: 732-819
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000256
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 850-937
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000172
Family I set domains 0.053
Further Details:      
 
Domain Number 5 Region: 216-303
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000769
Family I set domains 0.034
Further Details:      
 
Domain Number 6 Region: 566-654
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000172
Family I set domains 0.03
Further Details:      
 
Domain Number 7 Region: 488-560
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000336
Family I set domains 0.023
Further Details:      
 
Domain Number 8 Region: 126-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000362
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301627538|gb|XP_002942931|
Sequence length 938
Comment PREDICTED: Fc receptor-like protein 5-like, partial [Xenopus (Silurana) tropicalis]
Sequence
mikamfefskemckkfalyfagrrrkaeqrskelavennkdseedhdmallqkhfmpvqf
fgtqehrvselipkpkirvspkvitegsdmpiscycpvssqlkpilqfalykdettmief
ssaklfskpvikvspnsagdtlsltcdtqrgrygentqlefvfnkgrnevqrslsseyrl
psawaqdsevficaaatsdnrvykwsdhitiqrteplvirmnpysvtegdtlsltcdtqr
grygentqlefvfykgrnevqrslsseyrlpsvrvydsgeyrcaaatpdntvyrwsstit
iqipemfskpelrvssnpitegsaltltcgttpstvstrelqftfywdgqelqgftssnq
yrvysvqledsgnysckvqhpaksilktselfyiqvvggavrpvvslspnwaniltgdwv
tltcdvgstagtapryswykdnkmmnkdtptkeyiiyyaletnsgtyqcqtgtsersepv
slsvtdgplilqappyvyegdsltmrcysksggdtvfykdnnpvaptygdqlhtegvnmt
vtgtyrcskgktyqsdsvfisvrelfsrpkikvrpsplaegsnmtitcdtalhpsrittp
llfafyingntvrefslsriyrvcsvgpgdwgdyscavrtptgtvlklsnvtqihekgkn
fllsvglpllviliiiiavgiyklrhkagqtrrssdqsntamaegdpseeqygsyelitd
ypvvyeytehlpnpelrvspdlitegshislpchshslpkdtlefalyrdgfilhpfakd
ntwhiysfekehsgnytcavisspspkdiklsntvnihikatvtgesgdypnhngnkggn
ahnrhtehlpnpelrvspdlitegshisltchshsmpkgtlafalyfkgefqhtfsqynt
whiesvkkeysgnytcavkssasskdiklsntvniqik
Download sequence
Identical sequences gi|301627538|gb|XP_002942931|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]