SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301627723|gb|XP_002943019| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301627723|gb|XP_002943019|
Domain Number 1 Region: 117-379
Classification Level Classification E-value
Superfamily vWA-like 2.09e-49
Family Integrin A (or I) domain 0.00000669
Further Details:      
 
Domain Number 2 Region: 400-661
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.76e-43
Family Eukaryotic proteases 0.0000209
Further Details:      
 
Domain Number 3 Region: 14-74
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.00017
Further Details:      
 
Domain Number 4 Region: 79-135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000133
Family Complement control module/SCR domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301627723|gb|XP_002943019|
Sequence length 678
Comment PREDICTED: complement C2-like [Xenopus (Silurana) tropicalis]
Sequence
mrsstgkkyssvsckkmvcpqpeafengeffprgpyyvganvtfncndgytlrgsaertc
grnarwsgvtavcddgaghcpnpgippgamktgvrydmdnsikyacsrgmslvgsphrtc
lesrrwsgteiscqypysfdlpedvqeqfkaslsgilnikersasfgrtikikrdgilnv
yflldasrsvgeanfdiykecsvylvdelasfdmtiqfgiisyatvpkviipiydensdn
dahvfeviendlkysdhkdktgtniktaleevynmmsfqketyknesvwnsihhiiillt
dgkaniggrpadtikhieefldikkkredyldvytfgigpdvdmadlseiaskkdgeshv
frmesanemktvfqkivdikhygdmcglndespesesslhfpwnvlvksrrsvagpclgs
liskswvlsaahcfkegeladaydfqigrqsykaktieihncynisrkksknvnedydyd
valvqlkenvkfskearpicipctepanramkrvkgstckdhreqlmgvsqipagylskn
nkneliekrvfiktnkdreacvasvqkwpkfehinpvllvssrhlcvegemsckgesggs
lfvhlrgrrrffqvgvlsfgifnpcsrpgqrelpppgseprdfyidimqilpwmrkhigd
eldflpdiqkqdmtvcps
Download sequence
Identical sequences gi|301627723|gb|XP_002943019|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]