SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301627727|gb|XP_002943021| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301627727|gb|XP_002943021|
Domain Number 1 Region: 179-447
Classification Level Classification E-value
Superfamily vWA-like 1.48e-47
Family Integrin A (or I) domain 0.00000797
Further Details:      
 
Domain Number 2 Region: 472-691
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.08e-38
Family Eukaryotic proteases 0.00000384
Further Details:      
 
Domain Number 3 Region: 74-136
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.00027
Further Details:      
 
Domain Number 4 Region: 141-198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 5 Region: 33-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301627727|gb|XP_002943021|
Sequence length 705
Comment PREDICTED: complement factor B-like, partial [Xenopus (Silurana) tropicalis]
Sequence
mlllllithvsvslavqcdltkvgiiggnytvsnggnvgskveyqcpkgkyphpkytrec
lynglwtdhkmkaickdvrcpkpvafdggdyeprqhfytvgntlqfecytgfelkgsqnr
tcqenakwsgetticddnngycpnpgipigasksgtsykmeskvsytcqqglvmfgsker
eclenkdwsgtepscrqwytydtprevakgfsssmlenvdttnlegrsdrkvqilkdglm
nifivldtsksvgkdkfneakeasilfiekvssydikpqyciisyaseaipvvslrdqds
knadaviehlenfvydshadkqgtntraalhsiyqqlieqelvyknnnnkesfmkihnvi
llmtdgkfnmggdpreemkvirrflnvgtskddlreeyldvyvfglgsdidqpeindlas
kkdkevhtfhlenvdkmkeffelmidesdvmdtcglskyhsvdpdkrtrasemfpwiaki
tisgssvqyckgtilspyfiltaahcfhlddknqkiqviidgkeypvkqpyrhpkynpis
kvdknikrafdydvellelqkkiefsvtarpicipctqstaqvlkvpgapcsshekalls
eeevkaifiaeesknpleqknviikrgskrtacleaakkapelknvtdiedavteqflct
ggiepvvdppvckgdsggpliipvrrryvqvrlwhdfslgrmtmd
Download sequence
Identical sequences gi|301627727|gb|XP_002943021|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]