SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301628007|gb|XP_002943157| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301628007|gb|XP_002943157|
Domain Number 1 Region: 104-351
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-37
Family Kelch motif 0.022
Further Details:      
 
Domain Number 2 Region: 41-79
Classification Level Classification E-value
Superfamily F-box domain 0.00000000128
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301628007|gb|XP_002943157|
Sequence length 685
Comment PREDICTED: LOW QUALITY PROTEIN: f-box only protein 42 [Xenopus (Silurana) tropicalis]
Sequence
mavsseseddafmaidseegtmeqdeelpprgarlrgrhsqlmaempeevleyilsflsp
yqehktaalvckqwyrlikgvahqcyhgfikavqdgniqwesrtypypgtpitqrfshsa
cyydanqsmyvfggctqsscnaafndlwrldlnskewirplasgewpxpgsggtpvvyke
llvlfggwtrpspyplhqperffdeihtyspsknwwncivtthgpppmaghsscvigdkm
ivfggslgsrqmsndvwvldleqwswskptitgscphprggqsqividtetililggcgg
pnalfkdawllhmhecpwtwqqlkveneehgapelwchpacrvgqcvvvfsqapsgrapl
spslnsrpspisatppalapdpkeyrshspvrapdeapcvngrwgtlrpraqrqntggsr
egslspargdglspvlngggvspgasldsplqvlsppaaevcgtrksslpeqrdlclgas
dyewerkrrdpeldsagrtpseqtnglhtpphitttlsgavspgalrrgleavralasss
psapqsgasprspptlpspgspssgaesaprpvqaqneghslpaiarrlghhppqslnvg
kplyqsmnckpmqmyaldirgarergrvkwkvfnsssvvgppetslhtvvqgrgeliifg
glmdkkqnvkyypktnalyfvrakr
Download sequence
Identical sequences gi|301628007|gb|XP_002943157|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]