SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301629147|gb|XP_002943709| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301629147|gb|XP_002943709|
Domain Number 1 Region: 54-322,422-483,512-531
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.1e-25
Family Glycerol-3-phosphate transporter 0.049
Further Details:      
 
Domain Number 2 Region: 339-391
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000707
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301629147|gb|XP_002943709|
Sequence length 579
Comment PREDICTED: solute carrier organic anion transporter family member 1C1-like [Xenopus (Silurana) tropicalis]
Sequence
maelpccclhwdvamkpdfllfqnqhqrrrwnyparsgavapvakrgcdkdfgnsmwiyv
llgnllrgigeapiqplgisyiddyasedntafyigcvqtsavigpifgfllgslcaklf
vdigsvnldsvtitpadaqwvgawwlgyliaggiivlatipfwflpkeqprvetgktpst
pseqsrfileeqkeatteqdgvhllnmakdflpsvkdlfgnpvyflylcgsvfqynslig
mvtykpkyieqqygqtssktnfliglinipavalgifsggvimkrfrinilgaaklllgp
sllgylvllslfamgcknssvagltvsyqgsaqisyqenevsecnvgckcpqthwdpvcg
engltyysacfagcrvsngtgkraefyncscvgapmsqpggggsavagpcargtdcsnmf
lyfvvtsvmtsfalslggtpgymlllrcikpelksfalgiytlvirvlagipapmylgal
idtvclrwssrscagrgacrfyntdafryiylgmtlalgtvfifmtaavvlmvqkrfhpt
enkaeddgcassalpqngnlasnlhllqtthwaqketrl
Download sequence
Identical sequences gi|301629147|gb|XP_002943709|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]