SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301629238|gb|XP_002943750| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301629238|gb|XP_002943750|
Domain Number 1 Region: 25-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000232
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301629238|gb|XP_002943750|
Sequence length 176
Comment PREDICTED: hypothetical protein LOC100491641 [Xenopus (Silurana) tropicalis]
Sequence
mgayryflvwilllaalgsvsclqvegivgesvnlsiklnlpaqllvqwgfgtnihivta
fpdttpqyfgayrgrctlygntnlrldnltpidtgeytltvtnmdtgaiqsgsvyltvys
pvappilkvflpttngnaypgaspgvshrdvqkvfvaghmglgagsqsildqdqad
Download sequence
Identical sequences gi|301629238|gb|XP_002943750|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]