SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301629403|gb|XP_002943830| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301629403|gb|XP_002943830|
Domain Number 1 Region: 518-622
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 199-298
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00085
Further Details:      
 
Domain Number 3 Region: 301-406
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0034
Further Details:      
 
Domain Number 4 Region: 408-513
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0029
Further Details:      
 
Domain Number 5 Region: 75-184
Classification Level Classification E-value
Superfamily vWA-like 0.000000717
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301629403|gb|XP_002943830|
Sequence length 1030
Comment PREDICTED: hypothetical protein LOC100496982 [Xenopus (Silurana) tropicalis]
Sequence
malclpqcagcsqdaqtsaqilivddghhygtnvhnlhmvwgfaqglanphsdlqlhips
tlpeklsesvrgaeslkgisyqthdlfmgdylqkivwdafhrtrdvwgkkprlliifeyw
flntsrmsaltllktlgveifvvayrklenveemasyptethvfhwqqyrdpnamlsela
lsvcrsleghrhkksilsqvrlaggsgpcegrvevfynqtwgwlsdekwdplgadvvcrq
lgcgpsmevvkgdhfglgtghvlgrgncngheqdfsqcilgawkekeenqqsagvtclas
gvgdvrlvngsglcngivevtlnnsprrvciwgydsreaavtcrqvgcgplmkmqenlae
pgaevpmvekihcsggeadlskcsvslwreqpcflsvsaglvcaqsppsgiqlvggssvc
sgkvrvnyggswgsicadewgrleevvvcrqmgcgpaidtaewkmpsslsrssgnvleav
ychghesqlsecgsvsatsktcyipeaevlcsqsvisqvalvngptgcsgrvevyykgkw
gtvcdetwdladanvvckelgcgsateapkaarfhpgdgpiwlekvfcngneahlsecga
vtsrrgvcdhsqdagvicsgpsspatsprpephaippnqeaapvkdfsqfidwlqnhint
svqqavsaqtqskqhrpkvqpstsaqtasttissqsdsvsdsessgtassqysdsqsdee
stikqpddikailrhlydtleikqvnpplskidkvlgnapkksrsfptsksiiqsiteew
sdpdkrnsiskklmckfpvadelaqvwdkspkvdsaivrlsrnttlpsedagsfrdpmdr
kiesalkrdflhstailrpasaalsvartaqfwcqelkrsqdsaeldklglafsflgeas
lemaklatkasaaaiaarralwlrqwsgdttsknrlvslkfegtqlfgpelkkiisdvtg
gkgsflpqtkknrrethkrnyhhrswnqsynrqanrgrqnsnqfnsrrqktwqplskttr
kggppkpqds
Download sequence
Identical sequences gi|301629403|gb|XP_002943830|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]