SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301630510|gb|XP_002944360| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301630510|gb|XP_002944360|
Domain Number 1 Region: 40-85
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000196
Family Elafin-like 0.0014
Further Details:      
 
Domain Number 2 Region: 88-132
Classification Level Classification E-value
Superfamily Elafin-like 0.00000602
Family Elafin-like 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|301630510|gb|XP_002944360|
Domain Number - Region: 8-37
Classification Level Classification E-value
Superfamily Elafin-like 0.00115
Family Elafin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301630510|gb|XP_002944360|
Sequence length 133
Comment PREDICTED: WAP four-disulfide core domain protein 5-like, partial [Xenopus (Silurana) tropicalis]
Sequence
fhsesckvpnprgchgdqycpkgqkcccsdcgwkcvtaervkpgrcppimprcvgpppkp
scqtdgdcsgrqkcctlcgkvcqdpheesegacpvpsdprklqcpsvycarnddcltpqk
ccqsggkqrcmhv
Download sequence
Identical sequences gi|301630510|gb|XP_002944360|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]