SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301630944|gb|XP_002944573| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301630944|gb|XP_002944573|
Domain Number 1 Region: 547-653
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00059
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00039
Further Details:      
 
Domain Number 3 Region: 229-334
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 4 Region: 442-547
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00066
Further Details:      
 
Domain Number 5 Region: 110-216
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 6 Region: 649-747
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 7 Region: 331-442
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301630944|gb|XP_002944573|
Sequence length 754
Comment PREDICTED: deleted in malignant brain tumors 1 protein-like, partial [Xenopus (Silurana) tropicalis]
Sequence
tdenvrliggdnecegrvevkhqgtwgtvcgrqwgakeasvvcrqlgcntsneyfstkat
ffgagsgkiwlsnvkctgdepslawcmhntwgiekcdhtedvgvictgepeelrlvggnn
ecegrvevkhrgvwgavcdhnwnqkaasvvcrqlecnnttegymkaqaasfgqssrnisl
srvkctgeeavlwecqhqmwglsnclhradvgvickalscmltgepdllrlvgggtncag
rvevkhrgewgtvcddfwnenaaevvcrqlgcstsyedtahikatpfgaasgkiwlsrvr
ckgeesslrdcdhnmwglhycshsedagvicgdhreprlvdgpnscsgnlevkhggtwgs
vceiddelrtarvicrelgcgpavpapwkynnndknvksaqiwtekikctgnesslfecy
rvprpgrtctnpssptihclgpysgfrlvngtqrcsgrvevlytgqwgalcksnwdlhaa
nvlcrqlqcgtavsipngryfgksdfvwtdrfhckgteshlgecsfaalgnsdcsrddla
gvvctesllirlvdsphrcagrvevyhqgewgmicddswdkadanvvcrqlncghaisis
tmshketgngaawlsginctgsetalwqcpfnnwgqhsctkkqdarvkcseftdlrldgg
shecegrlevyyngswrsvcnnhmdqvsisvicrhlncgtkgirpitftygaadppywld
likcrkhdqsfwqcpsspwakhscnlqaevaeik
Download sequence
Identical sequences gi|301630944|gb|XP_002944573|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]