SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301631033|gb|XP_002944614| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301631033|gb|XP_002944614|
Domain Number 1 Region: 110-245
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-23
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 21-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.91e-20
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301631033|gb|XP_002944614|
Sequence length 252
Comment PREDICTED: HTH-type transcriptional regulator lutR-like [Xenopus (Silurana) tropicalis]
Sequence
mhdspitaapqntrphfsslarpsnlpdaiasqlrqtilagrlepgtrlapeqvlatqfg
vsrnvvreaiarlklsgyvqtrhgigsfvaadagqrsfelaseevltlpqleqahqlrve
vesgaaalaatmrseealqairrsllrgdqaghdwelgtetaldfhmaiakatrnphfvr
llthmryvirdavksmrirsvgserinligiehrsilaaierqdsdgarlamrthldngl
acyrknltrkts
Download sequence
Identical sequences gi|301631033|gb|XP_002944614|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]