SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305377062|ref|NP_001182159| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305377062|ref|NP_001182159|
Domain Number 1 Region: 235-486
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-64
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.00000000676
Further Details:      
 
Domain Number 2 Region: 498-572
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000000877
Family Blood coagulation inhibitor (disintegrin) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305377062|ref|NP_001182159|
Sequence length 843
Comment ADAM metallopeptidase domain 17 [Xenopus (Silurana) tropicalis]
Sequence
MKVLRLMGQLSLVEVIFALLLCLVVAEADHIPFGSQKEMPAKHQGLDSLLSEYDVLSLSS
IQQHSLRKRDLQSQSQLERMLSFTALQRHFKLYLTSSTELVSENLEALVLDGNGKEKKYQ
VKWSDFFTGHVVGEHNSKVLAHIGDGDFTARITTDGEEYNIEPLWRFVENTSGDNMLVYR
SGDIKDFSRLKSSKVCGYIKPKEDLFKNEQDTAESAEGDDYLHREKRQRAGPDSLRNTCK
MLVVADHRFFKYMGRGEESTTINYLIELIDRVDDIYRNTSWDNNQWKGYGVQIEQIIVHK
EPENVTQGQKHYNMARAFPNPDKDAWDVKQLLEQFSYDISEKAAQVCLAHLFTYQDFDMG
TLGLAYVGSHKPNTHGGICPKAYENDLSKKAVYLNTGLTSTKNYGKTILTKEADLVTTHE
LGHNFGSEHDPDSMEACAPSEDHGGKFVMYPIAVSGDHENNKMFSSCSRESILRTLMAKS
PICFKERNNKVCGNSRVDEGEECDPGLLHQHNDPCCTSDCKFQPGVHCSDRNSPCCRGCQ
FESAQKKCQEAINATCKGESYCTGSSSECPTPGNAENDTVCVDLGKCVNGECRPFCEIER
NLKSCACNDTENSCKVCCRDENGVCSPQKDQHDHFLYLRKGKPCTVGFCDANGKCEKQVQ
DVIERIWDFIDKLSINMFGKFLADNIVGSVVVFSLLFWIPLSILVHCVDKKLDKRYEETT
KSLFTPSNVEMLSSMDSAPVRIVKPSPSSQATNRFQALQTVPIVPTSAGAATKADHQRMD
TIQEDPSVDSHLDDQFEEDHFPNSGSPAKSFEDLTDHPVVRSDKASSFRLQRQGRVDSKE
TEC
Download sequence
Identical sequences E2IFV1
gi|301079087|gb|ADK56773| gi|305377062|ref|NP_001182159| NP_001182159.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]