SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|308193352|ref|NP_001184039| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308193352|ref|NP_001184039|
Domain Number 1 Region: 199-271
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.27e-22
Family Thyroglobulin type-1 domain 0.00042
Further Details:      
 
Domain Number 2 Region: 125-190
Classification Level Classification E-value
Superfamily Class II MHC-associated invariant chain ectoplasmic trimerization domain 1.96e-21
Family Class II MHC-associated invariant chain ectoplasmic trimerization domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308193352|ref|NP_001184039|
Sequence length 291
Comment HLA class II histocompatibility antigen gamma chain-like [Xenopus (Silurana) tropicalis]
Sequence
maeetqnlvpehvpeesvvdvgnrqprmscnkgslvtaltvlvavlvagqavmayfitqq
nskiqkldqttkhlqlkdmmknlpgsppaqikskmrtfnipmalklydgsetnmnelehl
aqidnkvedaakymllrgnplrkytlpngtilenlrelkksltdqewmnfdawmhqwylf
flvqntgkaaeplppqkniavtgaplmtecqtlsriptltgaykpqceqngdfkprqcwp
stgycwcvyrngtevpdsrtrwsrpacsdvmepeepiflgstpsddfnpid
Download sequence
Identical sequences NP_001184039.1.99540 gi|308193352|ref|NP_001184039|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]