SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|308522721|ref|NP_001184160| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308522721|ref|NP_001184160|
Domain Number 1 Region: 34-187
Classification Level Classification E-value
Superfamily L domain-like 4.42e-30
Family Internalin LRR domain 0.02
Further Details:      
 
Weak hits

Sequence:  gi|308522721|ref|NP_001184160|
Domain Number - Region: 821-926
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0183
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0089
Further Details:      
 
Domain Number - Region: 609-713
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0549
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|308522721|ref|NP_001184160|
Sequence length 1032
Comment leucine rich repeat and coiled-coil domain containing 1 [Xenopus (Silurana) tropicalis]
Sequence
mastapgsrelslmdkqirnlleiclhshlysinlhcnhiskieglghlcylqhldlssn
litkiegldsltclqslnlscnkltwveglgklfnlkklnlsynriqdltgfiplhgrnh
klshlylhsncinnieevlqsmvglncllhltleqnakgnpvcnvlgyreiilenlpqln
sldgidrsgvpvtahevdsmdlanldfleylinfdsgrkevkesasgpvktaridevltk
yrkqraaseainfstditsssehdiarfhdnsnilreirikkledqisellmkascpise
qttlkakrdtdfttesdsesskdnrkgsttrtpgcrktsqaskhqkhqasqqskgrtsvg
epkqnvsrkqplsktqskadietsvssgrtgstgqipgkphalegslkkkgelirnatee
styralvqdldqererrwkaeqvvlkltdsikelqnqakkkkkvnsmavyttdrikellf
keksaksklqelihhlkeenqkladelkklkdkeedyqrayksmddtlakletqriqqaa
lemkqvqeaerkvsasqreidllraslrqqkekvhqlhelltskeqlhrkelearvalng
pefqdalakemakeahrhsqeihsfqekmnlltrqyadledefraaliieagrfkdvkdg
fdnvaaelaehkeivnrclqkekqsatliqeltamvkeqkariaeitkakqdiisdlksk
ihslekvaeegrqktvqiellkqeksklisqltaqeslidglkaerkiwgqeltqqgvsl
aqdrgrleakievlsteieslkkqnerdtdtlriktkvvddqtetirklkeglqerderi
rklreeniqlektlreqsderttqleelkeklerqterkeevkqlleekeseledvkkay
samnkkwqdkaellsqletqvrqmkenfdakerklieerdkslqsqkvtteklrsvddaf
rrqlesvlsahqaeliklasdkqkeieaanervyqveeemrqllketanskkimeakikr
ltgafsdiqkef
Download sequence
Identical sequences gi|308522721|ref|NP_001184160| NP_001184160.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]