SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38648955|gb|AAH63333| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38648955|gb|AAH63333|
Domain Number 1 Region: 314-588
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-61
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 17-128
Classification Level Classification E-value
Superfamily POZ domain 2.89e-30
Family BTB/POZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38648955|gb|AAH63333|
Sequence length 606
Comment Kelch repeat and BTB (POZ) domain containing 10 [Xenopus tropicalis]
Sequence
MDPTGEIKDELRLYQSTLLQDGLKELLDENKFVDCFLKAGSKSLPCHRLILAACSPYFRE
FFLSDESEEKKKNMELDNVEPSTMEAILKYLYSADIDLNDGNVQDIFALASRFQIPSVFT
VCVTYLQRRLSPANCLAIFRLGLLLDCPRLAVTARDYVCDRFMQICNEEDFLQLAPHELI
AVISSDGLNVEKEELVFEAVMKWVQTDKENKTKSLSDVFDCIRFRLMPEKYFTDKVEKHD
LIKANPDIVKKVKVIKDAFAGKLPEGSKGKENSGKEGEDGDVGDEDLLPGYLNDIPRHGM
FVKDLMLLVSDTAAVAYDPLENECFLVGLSEQIPRNHSSIVTKSNQVYVIGGLYVDEENK
DQPLHSYFFQLDSIAGDWIGLPPLPSARCLFGLGEADDCVYAIAGRDLQSEESLDSVFCY
DSKAVAWTEVKKLPIKVYGHSAVSHNSQIYCLGGKTEDKKCTGRMFVFNPKKGEWKDLPP
MRTSRSMFGVTVHKGKIFVVGGVTEEGLTASVEAYDIATNKWETLAEFPQERSSINLVSV
GGSLYAVGGFAMIQLESKEFAPTEVTDVWKYEDDKKEWSGMLKELRYAAGATCLDTRLNL
FKLTKL
Download sequence
Identical sequences Q6P4N4
NP_989214.1.99540 gi|38648955|gb|AAH63333| gi|45361273|ref|NP_989214|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]