SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45361485|ref|NP_989319| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45361485|ref|NP_989319|
Domain Number 1 Region: 77-153
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.57e-23
Family RPO3F domain-like 0.0000322
Further Details:      
 
Domain Number 2 Region: 11-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.53e-21
Family RPO3F domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45361485|ref|NP_989319|
Sequence length 314
Comment polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa [Xenopus (Silurana) tropicalis]
Sequence
MSEAKVKQEGGEAAEIENRVIELCQQFPHGITDQVIQNEMPHIEAKQRAMCINRLLATGQ
LDLLRSGAGLLYRLKDPQTAGKMKGSDNQEKLVYQIIEDADNKGIWSRDIRYKSNLPLTE
INKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQ
QCFKFLQTKAEAARDSKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTL
IYDGKVEMTIIAAKEGTVGSVDGQMKLYRGVNPITQPAGLVRTPCGLCPVFDDCHEGGEI
SPSNCIYMTDWLDF
Download sequence
Identical sequences Q6P325
NP_989319.1.99540 gi|39794390|gb|AAH64209| gi|45361485|ref|NP_989319| ENSXETP00000053524 8364.ENSXETP00000053524 ENSXETP00000053524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]