SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45361537|ref|NP_989345| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45361537|ref|NP_989345|
Domain Number 1 Region: 27-187
Classification Level Classification E-value
Superfamily Lipocalins 6.55e-40
Family Retinol binding protein-like 0.0014
Further Details:      
 
Domain Number 2 Region: 220-276
Classification Level Classification E-value
Superfamily BPTI-like 6.1e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00054
Further Details:      
 
Domain Number 3 Region: 278-333
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45361537|ref|NP_989345|
Sequence length 342
Comment alpha-1-microglobulin/bikunin precursor [Xenopus (Silurana) tropicalis]
Sequence
MTACWALILLSGLLALGRSSPVQTQEDIQVQENFDLQKIYGKWYDVAIGSTCKWLKLHKD
KLNMGTLELSEGEADGEVRIVNTRMRHGTCSQIVGAYQKTETPGKFDYFNQRWGTTIQNY
IVFTNYNEYAIMLMRKKKGTETTTTVKLYGRSPDLRPVLIDEFQQFALAQGVPEDSIFTL
TNSGECAPGDIEVRPRRTQRAVLPEEEEGSGMENNPLSRNKGDSCRLAPAPGPCLGMHSR
YFYNSSTMACETFKYGGCLGNNNNFHSEKECLQTCRTEAACRLPITPGPCKAAKTHWAFD
AAQGKCVTFAYGGCQGNGNQFYTEKECKEYCGVVKDVSDELL
Download sequence
Identical sequences Q6P2V8
NP_989345.1.99540 gi|39850176|gb|AAH64278| gi|45361537|ref|NP_989345|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]