SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45708911|gb|AAH67937| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45708911|gb|AAH67937|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.34e-91
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45708911|gb|AAH67937|
Sequence length 330
Comment Protease, serine, 29 [Xenopus tropicalis]
Sequence
MLRLLCVVLSILHHQAYGGPVMSKRIVGGTDSEEGEWPWQISLEFEGGFLCGGSLLTDSW
VLTAAHCFDSMNVSKYTAYLGVYQLSDLDNAVLRGVKNITVHPDYMYEGSSGDIALIELE
EPIVFTPSIQPVCLPSQDVPLPMGTMCWVTGWGNIKENTPLEDPQTLQKAEVGLINRTSC
EAMYQSSLGYRPSIHLIQDDMICAGYKQGKIDACQGDSGGPLVCNTSNTWLQFGIVSWGL
GCAEPNQPGVYTNVQYYLTWIQELVPSVMFCDGEPSIATTTFTDLSQSVSISSDLDGAFR
ENLKNRAHTQSWSLVTIALSLICLCNGLLL
Download sequence
Identical sequences Q6NVR7
8364.ENSXETP00000013813 gi|45708911|gb|AAH67937| gi|47575768|ref|NP_001001228| ENSXETP00000013813 NP_001001228.1.99540 ENSXETP00000013813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]