SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49899935|gb|AAH76947| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49899935|gb|AAH76947|
Domain Number 1 Region: 487-584
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 5.23e-32
Family Mitotic arrest deficient-like 1, Mad1 0.0000644
Further Details:      
 
Weak hits

Sequence:  gi|49899935|gb|AAH76947|
Domain Number - Region: 118-255
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.034
Family HBL-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|49899935|gb|AAH76947|
Sequence length 718
Comment MAD1 mitotic arrest deficient-like 1 (yeast) [Xenopus tropicalis]
Sequence
MDDSEDNTTVISTLRSFNKFLSQPLEGTAPSLGTSTSTGASLQMQFQQRFLLEDQAAQIR
SKSHLIQVEREKMQMELSHKRARIELEKAASTNAKNYEREADRNQELITRIKALEEREND
FQNKLQEQNEMIKSYKKTIEAQSKKLLEKEDKLSELNENISVLKGKATELQWKIMNQEMQ
IKTQETEKQEMTEQLEIHRKKLQESNEKMQALHELQAQNVDNEQKIKSLEQKLSAQEQDA
AIVKSMKSDLAKLPKLERELQQLRDENAYHREMKENNALLKEEVEGLRRAAERFNKMKED
LVGLEIEKEQLLKKLKLWESLEHTTGLNIRTPDDLSRQIIAVQQRELKLKEENMTIQNSA
RMLETSRQQLREELLKVQAGFLEEKKRREHQEAFVRRLQKRVLLLTKERDGMRAILDSYD
SELTPTEHSPQLSRRLREAEDMVQKVQDHNAEMETQLSEALEETGIQKQKSDLLMAELKV
LKSQMGSSDQNISFTNEAMNTLRLKIEELEAERGRLEEENKILEMRLERLNLQGCYDPSK
TKVIHLGLNPSSQAKQQRAETVRQLQEECSKLRELVRILEGGAQIPDKLEAAGSVQSSQE
LTELKKQLESAELKNQRLREVFQTKIHEFRTACYMLTGYRIDITTENQYRLTSMYAEQKE
DNLLFKASGSSGGKMQLLETDFSLTLRDFIDLHLHHQNSIPAFLSAVTLDLFSRQTFA
Download sequence
Identical sequences Q6DEZ6
NP_001006927.1.99540 gi|49899935|gb|AAH76947| gi|55742174|ref|NP_001006927|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]