SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49903531|gb|AAH76975| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49903531|gb|AAH76975|
Domain Number 1 Region: 25-380
Classification Level Classification E-value
Superfamily Sema domain 1.83e-96
Family Sema domain 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49903531|gb|AAH76975|
Sequence length 429
Comment Plexin A3 [Xenopus tropicalis]
Sequence
MGPLQSLLLLFLTCSVGEGASVFPTFAVSDTSLTHLAVHKHTGDVYLGAVNRIFKLSENL
TELRSHLTGPIADNSSCYPPPSVRVCTHKLSPTDNVNRLLLIDYTGKRVVACGSVWQGIC
QFLRLDDLFKLGEPHHRKEHYLSGAREPDSMAGVIVDQDVEQSKLFIGTSIDGKSEYFPT
LSSRRLVQDEESAEMFRLVYQDEFVSSQIKVPSDTLSLHPSFDIYYVYGFVSKIFVYFLT
LQLDTQQTLLDATGEKFFTSKIVRMCSGDLEFYSYVEFPIGCTKDGVEYRLIQSAYLSRP
GRKLAQALGIPEDEEVLFTVFSQGQKNRSNPPRESVLCLFTLSQINLHIKMRIQSCYHGE
GKLSLPWLLNKELFCISTVSGCIGAFTEAQGPSPWRFHLSSQEHYPSHHLSFIELCHTVL
CGCAKGRRE
Download sequence
Identical sequences Q6DEW8
NP_001006866.1.99540 8364.ENSXETP00000007321 gi|49903531|gb|AAH76975| gi|55742296|ref|NP_001006866|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]