SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51703824|gb|AAH80883| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51703824|gb|AAH80883|
Domain Number 1 Region: 84-95,187-425
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-51
Family Nuclear receptor ligand-binding domain 0.00023
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51703824|gb|AAH80883|
Sequence length 435
Comment nuclear receptor subfamily 6, group A, member 1 [Xenopus (Silurana) tropicalis]
Sequence
MDTWEDDRVDQRACLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSR
KQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISDEEIERIMSGQEFEEEA
NTSWSNNGDSDHSSPGNGVSESNQPSPVSTPSSSRSMELNGFGSLRDQYLGTPGPMHYQY
LPHLFSYSAHPTLIPTQSRSLDPQSHTLINQLLTAEDIEPLSTPMLIEDGYKVTQSELFA
LLCRLADELLFRQITWVKKLPFFCDLSIKDYTCLLSTTWQELILLSSLTTYSKQIFGDLA
DVTSKYSPSEDELHRFSEDGMEVMERLIYLFRKFSQLKVSNEEYVCMKAINFLNQDIQGI
SSVSQVEQLNKRYWYVCQDFTEYRYPHQPNRFPDLMMCLPEVRYIAGKLVNVPLEQLPLL
FKAFLHSCKTSLTKE
Download sequence
Identical sequences A0A1B8YA22 Q66JK1
gi|51703824|gb|AAH80883| gi|56118937|ref|NP_001008005| gi|82198466|sp|Q66JK1| gi|89268659|gb|CAJ83090| ENSXETP00000018759 NP_001008005.1.99540 ENSXETP00000018759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]