SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51704011|gb|AAH80943| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51704011|gb|AAH80943|
Domain Number 1 Region: 191-239
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000018
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 2 Region: 262-317
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.0076
Further Details:      
 
Domain Number 3 Region: 98-164
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000846
Family Ovomucoid domain III-like 0.00026
Further Details:      
 
Domain Number 4 Region: 93-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Follistatin (FS) module N-terminal domain, FS-N 0.0026
Further Details:      
 
Domain Number 5 Region: 27-68
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000824
Family TB module/8-cys domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51704011|gb|AAH80943|
Sequence length 320
Comment follistatin [Xenopus (Silurana) tropicalis]
Sequence
MLNERIQPGMIFLLTVSLCHFMEHRAVQAGNCWLQQSKNGRCQVLYRTELSKEECCKTGR
LGTSWTEEDVPNSTLFKWMIFHGGAPHCVPCKETCENVDCGPGKKCKMNKKNKPRCVCAP
DCSNITWKGSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKTCRDVLCPGSSTCV
VDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCSAGKKCLWDSRVGRGRCALCDDVCGAESKSDDTVCASDNTTYPSECAMKQ
AACSTGVLLEVKHSGSCNCK
Download sequence
Identical sequences Q66JE7
NP_001008057.1.99540 ENSXETP00000057786 gi|51704011|gb|AAH80943| gi|56118530|ref|NP_001008057|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]