SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51950287|gb|AAH82504| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51950287|gb|AAH82504|
Domain Number 1 Region: 536-669,718-888
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2e-80
Family Protein kinases, catalytic subunit 0.00000000236
Further Details:      
 
Domain Number 2 Region: 197-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000367
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 96-190
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000584
Family I set domains 0.0087
Further Details:      
 
Domain Number 4 Region: 22-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000125
Family I set domains 0.041
Further Details:      
 
Domain Number 5 Region: 310-394
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000133
Family V set domains (antibody variable domain-like) 0.076
Further Details:      
 
Domain Number 6 Region: 404-478
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000495
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51950287|gb|AAH82504|
Sequence length 935
Comment Csf1r protein [Xenopus tropicalis]
Sequence
MYPAVLALLVATIVYYGMATPVIKEGGEIIVSPGDRVTLTCSGNQTVKWDIRKSTKWIVK
QSETISVLEIKSATYKETKSYKCVYNDTRYSGMASVHLYVKDTSYSWSTFSGTVVKMEEG
KDVVLPCLITDPSIPRANIQLESSSLNSANISFDYHKGFTIHGVQMENDGMYICKATVNG
HVRKSLEMRLFVIEVPRLPPNVTMEPQNDIRIKGEAFKITCKATGKVLPVLRWETPATDY
TVTNTTRLTLMDWTTTSTLYIHKVNFTDSGNYTCIGYYPSYASQLKRISTSLHVIEEGYV
RLTTLGNNRITLRAGESTNITILIDAYPSQLSWAWIHENHGNQSNVSSQAVVKPDGHYRN
VTILQLNRILEYEEGSYTFTAQNARANASLAFKIVLNRPPVVNKMWSINNTYTCTASGYP
LPKIEWSKCSENKICHENIKQPMTNYNIIVESHLTVTQNITSIVCKAFNSVGEDSREMEL
PRTFETSRPDQEKLFTPIVISSLILAGIFIVLSAFLYYKYQQKPKYEIRWQIIQPAEGNN
YTCIDPTQLPYNDKWEFPRTNLQFGKTLGAGAFGKVMEATAVGLGNEDSAVTVAVKMLKP
SAHTDEVEALMSELKILSHLGNHKNIVNLLGACTHGGPILVITEYCHYGDLLNFLRKKAQ
IMNEMFSASLEEQSSTSSDYKNMTIEHKYIKSDSGFLSKGTDSYVEMKPVSSLSSQGDSL
IDEKDTDDMLPLDLYDLLSFSFQVSQGMSFLSAKNCIHRDVAARNVLVSHGRVVKICDFG
LARDIENDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEMFSLGRSPYPG
IMVNRKFYKMIKEGYKMDCPDYAPLEIYRIMKTCWDLEPTQRPTFNQISTLISKQINILN
NQDYANISEDQQVQECMENKRESQPHFKGNNYQFC
Download sequence
Identical sequences Q640T5
NP_001008181.1.99540 gi|51950287|gb|AAH82504| gi|56118484|ref|NP_001008181|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]